Search Results

Search found 29256 results on 1171 pages for 'likewise open'.

Page 330/1171 | < Previous Page | 326 327 328 329 330 331 332 333 334 335 336 337  | Next Page >

  • An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll

    - by Sahar
    Hello everybody i wrote a code in asp.net that read data from files and draw a graph. It worked but after awhile when i run the program, this exception arise "An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll" in this statement in the code: if (File.Exists(fName)) <----(here is the exception) { stream = File.Open(fName, FileMode.Open); g_day = Deserialize(stream); stream.Close(); int cn = 0; if (g_day.Values.Count != 0) cn = g_day.Values[g_day.Values.Count - 1].Value; Label1.Text = cn.ToString(); } can u help me

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • How to limit results in a SharePoint XSL query

    - by David
    Hello all, I am creating a SharePoint site that we will use to report issues with trucks used in our business. Linked to the list I have created will be a page that will display an overview of the trucks and a little truck icon will show the trucks current status. Green and the truck is okay (no open issues), Red and the truck have an open issue with status "Undrivable", Orange and there is two issues open that requires the user to look further into the truck before using it and finally a Gray truck for when there is a new issue created that has not been looked into (not sure if it is drivable or not). I have managed to create the "Dashboard" and with my limit XSL/XPATH knowledge been able to add a truck and replicate the description above but... in my test I have created 4 issues, for example if three of them are changed to status Closed and one left to Undrivable I will get four icons on the page, three with Green trucks and the last one Red. So in theory it works but I obviously only want to see the last truck, one truck. I am not interested in seeing the others. <xsl:template name="dvt_1.rowview"> <xsl:variable name="CountReport" select="count(/dsQueryResponse/Rows/Row[@Highloader='GGEU12' and @Status!='Closed'])" /> <xsl:variable name="MoreThan" select="$CountReport &gt; 1" /> <xsl:variable name="NoReports" select="$CountReport = 0" /> <xsl:variable name="Closed" select=" @Highloader='GGEU12' and @Status='Closed'" /> <xsl:choose> <xsl:when test="$MoreThan"> <div class="ms-vb"><img title='More than one report exist!' border='0' alt='In Progress' src='highloader/Library/hl-orange.png' /></div> </xsl:when> <xsl:otherwise> <div class="ms-vb"><xsl:value-of disable-output-escaping="yes" select="@Icon" /></div> </xsl:otherwise> </xsl:choose> </xsl:template> My hope is that someone with slightly more knowledge can find the last piece of the puzzle for me! Thanks for reading and asking questions to fill any gap I left above. David

    Read the article

  • VB6 ADODB Fails with SQL Compact: Multipe-Step operation generated errors

    - by Belliez
    Hi, I am converting an old application to use SQL Compact database (it works ok with SQ Server 2005 and 2008) and using the following code gives an error when attempting to execute a simple select command: Private Const mSqlProvider As String = "Provider=Microsoft.SQLSERVER.CE.OLEDB.3.5;" Private Const mSqlHost As String = "Data Source=C:\database.sdf;" Private mCmd As ADODB.Command ' For executing SQL' Private mDbConnection As ADODB.Connection Private Sub Command1_Click() Dim DbConnectionString As String DbConnectionString = mSqlProvider & _ mSqlHost Set mDbConnection = New ADODB.Connection mDbConnection.CursorLocation = adUseClient Call mDbConnection.Open(DbConnectionString) If mDbConnection.State = adStateOpen Then Debug.Print (" Database is open") ' Initialise the command object' Set mCmd = New ADODB.Command mCmd.ActiveConnection = mDbConnection End If mCmd.CommandText = "select * from myTable" mCmd.CommandType = adCmdText mCmd.Execute ' FAILS HERE! ' End Sub I have referenced Microsoft ActiveX Data Access Object 6.0 Library in the project. The error I get is: Run-Time error -2147217887 (80040e21) Multipe-Step operation generated errors. Check each status value Just wondering if anyone has any suggestions? Thanks

    Read the article

  • AIR:- Desktop Application related to Window Component (Need some work around)

    - by Mahesh Parate
    Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

  • MySQL UNION query from one table + ORDER BY

    - by ilnur777
    I have one table with two queries and I need to sort it with descending type using ORDER BY. Here is my MySQL query that does not work properly: (SELECT `text` FROM `comments` WHERE user_fr='".$user."' && archive='1' ORDER BY `is_new_fr` DESC) UNION (SELECT `text` FROM `message` WHERE user_to='".$user."' && archive='1' ORDER BY `is_new_to` DESC) Description! is_new_fr and is_new_to counts total new messages. Here is my table contant: user_fr | user_to | archive | is_new_fr | is_new_to| text name1 | name2 | 1 | 2 | 0 | testing... name2 | name1 | 1 | 0 | 5 | testing ... I want to make an order that 1st will display note that has more messages to few, or by another words using DESCending type. This is the display on the page I want to do: Open dialog with name2. Messages (5) Open dialog with name1. Messages (2) Thank you!

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Proxy calls across a DMZ

    - by John
    We need to determine a quick way for our web application deployed in a DMZ to communicate to our SQL server that lives in the protected network. Only port 80 is open and available, and no direct SQL traffic is allowed across the firewall. So take the following simple system. A web page (default.aspx) makes a call (string GetData()) that resides in an assembly (Simple.DLL). GetData() uses ADO.NET to open a connection, execute a SQL call, retrieve the data, and return the data to the caller. However, since only port 80 is available and no SQL traffic is allowed, what could we do to accomplish our goal? I believe a .NET remoting solution would work, and I have heard of an architecture where a remoting layer proxies the call from Simple.DLL in the DMZ to another Simple.DLL that runs on the protected side. The remoting layer handles the communication between the two DLL’s. Can someone shed some light on how WCF/remoting can help us and how to get started with a solution?

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • Java library class to handle scheduled execution of "callbacks"?

    - by Hanno Fietz
    My program has a component - dubbed the Scheduler - that lets other components register points in time at which they want to be called back. This should work much like the Unix cron service, i. e. you tell the Scheduler "notify me at ten minutes past every full hour". I realize there are no real callbacks in Java. Here's my approach, is there a library which already does this stuff? Feel free to suggest improvements, too. Register call to Scheduler passes: a time specification containing hour, minute, second, year month, dom, dow, where each item may be unspecified, meaning "execute it every hour / minute etc." (just like crontabs) an object containing data that will tell the calling object what to do when it is notified by the Scheduler. The Scheduler does not process this data, just stores it and passes it back upon notification. a reference to the calling object Upon startup, or after a new registration request, the Scheduler starts with a Calendar object of the current system time and checks if there are any entries in the database that match this point in time. If there are, they are executed and the process starts over. If there aren't, the time in the Calendar object is incremented by one second and the entreis are rechecked. This repeats until there is one entry or more that match(es). (Discrete Event Simulation) The Scheduler will then remember that timestamp, sleep and wake every second to check if it is already there. If it happens to wake up and the time has already passed, it starts over, likewise if the time has come and the jobs have been executed. Edit: Thanks for pointing me to Quartz. I'm looking for something much smaller, however.

    Read the article

  • C# CF: file encryption/decryption on the fly

    - by nuttynibbles
    Hi, i've seen many article on encrypt/decrypt of file and typically a button is used to choose the file for encrypt and another button to decrypt the file. i've seen some application like truecrypt and probably others which does file encryption on-the-fly with transparent. this means that when a encrypted file is clicked to access, it will automatically decrypt and play/open the file. then when the file is closed, it will automatically encrypt again. some have said that the only way to detect file open is through file system filter. but is there other ways to do this in c# compact framework?

    Read the article

  • Subversion (20014)Internal error: database is locked on NFS

    - by Niraj Gurjar
    i have subversion setup using apache and DAV. OS is RHEL 4. Repository is created on NFS server mounted on this machine. when i try to access this repository i get following error in apache logs (20014)Internal error: database is locked Could not fetch resource information. [500, #0] Could not open the requested SVN filesystem [500, #200030] Could not open the requested SVN filesystem [500, #200030] The URI does not contain the name of a repository. [403, #190001] i did 'chmod' on that mounted partition but problem still persists. any help?

    Read the article

  • jQuery exclude elements with certain class in selector

    - by Alex Crooks
    I want to setup a click event trigger in jQuery for certain anchor tags. I want to open certain links in a new tab while ignoring ones with a certain class (before you ask I cannot put classes on the links I am trying to catch as they come from a CMS). I want to exclude links with class "button" OR "generic_link" I have tried $(".content_box a[class!=button]").click(function (e) { e.preventDefault(); window.open($(this).attr('href')); }); But that doesn't seem to work, also how do I do an OR statement to include "generic_link" in the exclusion? Many thanks

    Read the article

  • Problem extracting text from RSS feeds

    - by Gautam
    Hi, I am new to the world of Ruby and Rails. I have seen rails cast 190 and I just started playing with it. I used selector gadget to find out the CSS and XPath I have the following code.. require 'rubygems' require 'nokogiri' require 'open-uri' url = "http://www.telegraph.co.uk/sport/football/rss" doc = Nokogiri::HTML(open(url)) doc.xpath('//a').each do |paragraph| puts paragraph.text end When I extracted text from a normal HTML page with css, I could get the extracted text on the console. But when I try to do the same either with CSS or XPath for the RSS Feed for the following URL mentioned in the code above, I dont get any output. How do you extract text from RSS feeds?? I also have another silly question. Is there a way to extract text from 2 different feeds and display it on the console something like url1 = "http://www.telegraph.co.uk/sport/football/rss" url2 = "http://www.telegraph.co.uk/sport/cricket/rss" Looking forward for your help and suggestions Thank You Gautam

    Read the article

  • User preferences using SQL and JavaScript

    - by Shyam
    Hi, I am using Server Side JavaScript - yes, I am actually using Server Side JavaScript. To complexify things even more, I use Oracle as a backend database (10g). With some crazy XSLT and mutant-like HTML generation, I can build really fancy web forms - yes, I am aware of Rails and other likewise frameworks and I choose the path of horror instead. I have no JQuery or other fancy framework at my disposal, just plain ol' JavaScript that should be supported by the underlying engine called Mozilla Rhino. Yes, it is insane and I love it. So, I have a bunch of tables at my disposal and some of them are filled with associative keys that link to values. As I am a people pleaser, I want to add some nifty user-preference driven solutions. My users have all an unique user_id and this user_id is available during the entire session. My initial idea is to have a user preference table, where I have "three" columns: user_id, feature and pref_string. Using a delimiter, such as : or - (haven't thought about a suitable one yet), I could like store a bunch of preferences as a list and store its elements inside an array using the .split-method (similar like the PHP-explode function). The feature column could be like the table name or some identifier for the "feature" i want to link preferences too. I hate hardcoding objects, especially as I want to be able to back these up and reuse this functionality application-wide. Of course I would love better ideas, just keep in mind I cannot just add a library that easily. These preferences could be like "joined" to the table, so I can query it and use its values. I hope it doesn't sounds too complex, because well.. its basically something really simple I need. Thanks!

    Read the article

  • JSF HIBERNATE POSTGRESQL

    - by user312619
    When I press "Save" button I get an exception like that ; javax.servlet.ServletException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.webapp.FacesServlet.service(FacesServlet.java:325) root cause javax.faces.el.EvaluationException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:102) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause org.hibernate.exception.JDBCConnectionException: Cannot open connection org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:98) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause java.sql.SQLException: No suitable driver found for jdbc:postgresql://localhost/postgres java.sql.DriverManager.getConnection(Unknown Source) java.sql.DriverManager.getConnection(Unknown Source) org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312)

    Read the article

  • URL rewriting to a common end point

    - by sunil
    I want to create an asp.net white-label site http://whitelabel.com, that could be styled for each of our clients according to their specific needs. So for example, client abc would see the site in their corporate colours and be accessed through their specific url http://abc.com. Likewise client xyz would see the site in their own styling and url http://xyz.com. Typing either url, in effect, takes the user to http://whitelabel.com where the styling is applied, and the client's url structure is retained. I was thinking of URL rewriting using URLRewriter.Net (http://urlrewriter.net/), or similar, mapping the incoming address to a client id and applying the theme accordingly. So, a url rewrite rule may be something like <rewrite url="http//abc.com/(.+)" to="~/$1?id=1" /> <rewrite url="http//xyz.com/(.+)" to="~/$1?id=2" /> I could then read the id, map it to the client, and with a bit of jiggery-pokery, apply the correct theme. I was wondering if: this is the right approach ? I've overlooked something ? there is a better way to do this ? Any suggestions would be appreciated.

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Facebook Connect via Javascript doesn't close and doesn't pass session id

    - by ensnare
    I'm trying to authenticate users via Facebook Connect using a custom Javascript button: <form> <input type="button" value="Connect with Facebook" onclick="window.open('http://www.facebook.com/login.php?api_key=XXXXX&extern=1&fbconnect=1&req_perms=publish_stream,email&return_session=0&v=1.0&next=http%3A%2F%2Fwww.example.com%2Fxd_receiver.htm&fb_connect=1&cancel_url=http%3A%2F%2Fwww.example.com%2Fregister%2Fcancel', '_blank', 'top=442,width=480,height=460,resizable=yes', true)" onlogin='window.location="/register/step2"' /> </form> I am able to authenticate users. However after authentication, the popup window just stays open and the main window is not directed anywhere. In fact, it is the popup window that goes to "/register/step2" How can I get the login window to close as expected, and to pass the facebook session id to /register/step2? Thanks!

    Read the article

  • NetBeans ("6.8" and "later") - UML support?

    - by Petike
    Hello, I wanted to download the "UML plugin" to NetBeans through the "Tools/Plugins" but I didn't find the plugin there. Then I read in many articles that the "NetBeans UML plugin is not supported anymore" :-( . Then I discovered that there exists some "NetBeans SDE" tool that supports the UML in NetBeans and there exists the "Comunity Edition" of that tool which is free, but only for "non-commercial" uses - so it's not open-source - and so I don't want to use it. So I would like to ask, if Sun (or whoever else who officially maintains (or maintained in the past) the NetBeans UML plugin) is not going to support the UML plugin to NetBeans anymore and if so, is there any "open-source" UML plugin which is supported in version "6.8" and "later" and if so - which? Thank you.

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

< Previous Page | 326 327 328 329 330 331 332 333 334 335 336 337  | Next Page >