Search Results

Search found 35270 results on 1411 pages for 'nice line'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 359/1411 | < Previous Page | 355 356 357 358 359 360 361 362 363 364 365 366  | Next Page >

  • How to limit network usage for concrete application in linux that is running in it?

    - by B14D3
    I'm looking for something like nice for cpu, but for network usage that will limit application network consumption to level that will configure. I have problems with xapian-replicate-server that is consuming 80 % of my network. It's causing mysql connections problem (mysql server is working on this machine too). I can't move xapian or mysql to other machine so i need to limit xapian network usage to a decent level. Is there any tool that will help me do this ?

    Read the article

  • How to read iptables -L output?

    - by skrebbel
    I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

    Read the article

  • Can you recommend a good replacement for Windows Sound Recorder?

    - by andygrunt
    Can anyone recommend a good, free replacement for Windows 'Sound Recorder'? Requirements: Very quick to load and run Allows saving to a compact sound format (e.g. MP3) Allows long recordings (1+ Hours) Free Runs on Windows XP Would be nice but probably not essential: Saves along the way (in case of crashes) Allows simple edits (trim start and end and maybe remove chunks in the middle) Before anyone suggests it, I'm aware of (and have used) Audacity but I'm really after something as simple and lightweight as possible.

    Read the article

  • Is it possible to change the look and feel of remote X applications running under Xming?

    - by Rasive
    I am running Eclipse remotely right now, in Xming on my Windows pc, through an ssh tunnel from my laptop running Ubuntu 11.10. As seen below, it doesn't look that bad, but it seems that my applications defaults to the standard theme when it cannot find any others for GTK+ applications. Is there anything I can do about this? Also it would be nice if I could do something about the font settings to make it more easily readable.

    Read the article

  • PHPMyAdmin running very slow over internet but fine locally

    - by columbo
    I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

    Read the article

  • How do I allow a (local) user to start/stop services with a scheduled task?

    - by Mulmoth
    Hi, on a Windows 2008 R2 server I have two small .cmd-scripts to start/stop a certain service. They look like this net start MyService and net stop MyService I want to execute these script via scheduled task, and I thought it would be best to create a local user for this job. The user is not member of the Administrators group. But the scripts fail with exit code 2. When I logon with this local user and try to execute these script in command line, I see a message like (maybe not exactly translated from german to english): Error code 5: Access denied It doesn't matter whether I start the command line as Administrator or not. How can this local user gain rights to do the job?

    Read the article

  • How to prevent a Windows 7 PC from sleeping when CPU usage is over X%?

    - by MaxVT
    I often leave the PC running into the night to process video files, so it shouldn't sleep while it's working but it would be nice if it went into sleep when it's done. During the export the CPU is always above a set %, and when idle it's typically in the single digits. Is there some tool or setting that would prevent the PC from going to sleep as long as the CPU usage (let's say averaged over one minute) stays above a specified limit?

    Read the article

  • Virtual Box for everyday use?

    - by Mark
    I was just thinking about how nice virtual machines are...and how even "rebooting" is less painful, because at the very least, you don't have to wait for your physical computer to turn off and on with all the mobo shannanigans at the start... so, what if I ran everything in a virtual machine? Then I wouldn't really need a primary OS, I just need something than can run VirtualBox or what have you. So what's the lightest weight OS I could install, that supports a good virtual machine?

    Read the article

  • What is the usual procedure for working with remote Git repositories?

    - by James
    A slightly open question regarding best practices, I can find lots of functional guides for git but not much info about standard ordering of operations etc: Whats the standard/nice way of working with remote repositories, specifically for making a change and taking it all the way back to the remote master. Can someone provide a step-by-step list of procedures they normally follow when doing this. i.e. something like: 1) clone repo 2) create new local branch of head 3) make changes locally and commit to local branch 4) ...

    Read the article

  • Change keyboard mapping (Input Source) from terminal in OS X

    - by simont
    I'd like to change the keyboard mapping from command-line (Terminal) in Mac OS X Lion (10.7). I can manually set it (System Preferences - Language & Text - Input Sources), and there's a nice option that lets me use different input sources for different documents, but I'd like to bind it to a key under zsh to easily swap between Qwerty and Dvorak layouts (I'm learning Dvorak, and having the option to switch easily would be sensational).

    Read the article

  • Pretty/powerful CMD alternatives?

    - by w1sh
    I'm a Windows user and am just getting my feet wet with Python and some other languages. I keep having to deal with the Command Prompt, and it doesn't bother me, but I'm sure there are some free alternatives out there that look a lot nicer and probably pack a bigger punch. Any suggestions would be nice. Thanks!

    Read the article

  • Opendns like 404 page [migrated]

    - by Dmbekker
    People who use OpenDNS and go to a non-existing domain are getting a nice fancy search page telling them that the domain doesn't exists instead of the browser error page. here in my home network we have a win 2008-r2 server with the dns role enabled. Is there any way to make my own fancy looking error page to show up at all computers when they enter a domain not found by the local dns server and the Forwarders / root hints servers? -- David,

    Read the article

  • iPhone Docked Playing Through PC, Buzzing.

    - by DrFloyd5
    Hi. I have an iPhone that I fit into an Apple dock. There is an audio cable from dock into the line in on my sound card. My headphones are plugged into the line out. I get this really quite buzz that is fairly constant, but changes as the iphone "does stuff". It's not so bad when the music is playing. But when it stops I get the buzz, so I can't really use my headphones as "noise cancellation." It doesn't help to change my volume sliders on the PC. Any ideas? Thanks in advance.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Why does Notepad "randomly" make pasted text a smaller font size?

    - by Coldblackice
    Sometimes when I copy and paste text into Notepad, it will paste the text in the default Notepad font and size, however, the latter half of the pasted line will be multiple font sizes smaller. I'm stumped as to why this is happening. I wondered if it was perhaps some type of hidden formatting that was being copied into Notepad, but I believe that Notepad strips the formatting. I've subsequently taken the same text and tried copy and pasting it into URL bars and CMD prompts to strip any potential formatting (even though it was plaintext copied from web), and then re-pasted into Notepad, but it still leaves this phenomenon. Additionally, when resizing the Notepad window, it will change what portion of the line is default sized and downsized, as seen in the screenshot posted below. The three windows are actually the same Notepad window, each with a different resizing and the resulting text resizing.

    Read the article

  • What's the advantage of using a bash script for cron jobs?

    - by AlxVallejo
    From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

    Read the article

  • How to install php cli with pnctl alongside Zend Server

    - by fazy
    I have Zend Server CE 5.6 with PHP 5.2 running on Ubuntu 11.10. Now the need has arisen to run a command line PHP script that uses PHP's pnctl functionality. First of all, I had no PHP command line in my path, so I made a symlink from the Zend one: sudo ln -s /usr/local/zend/bin/php /usr/bin However, when I run my script, I now get this error: PHP Fatal error: Call to undefined function pcntl_fork() The Zend web control panel doesn't offer pnctl in the list of modules, so how do I get this functionality? Is it safe to use apt-get to install PHP directly, to run alongside the Zend instance? If so, how do I make sure I get version 5.2? I guess the following would pull in PHP 5.3: apt-get php5-cli I could probably muddle through but any pointers to help me avoid making a mess would be much appreciated!

    Read the article

  • Transfer disk image to larger/smaller disk

    - by forthrin
    I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

    Read the article

  • Custom prompt doesn't work on Mac Terminal

    - by mareks
    I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

    Read the article

  • Best tool to backup your firefox shortcuts

    - by vaccano
    I have lost my shortcuts a few times (from hard drive crashes). Is there a good tool to back them up easily. (I would prefer to not have to remember to do it.) Backing them up to the internet would be a nice bonus, but it is not required for my needs.

    Read the article

  • How to Transpose in Excel a column with more than 50,000 rows?

    - by ezlee69
    I am trying to Transpose all of column "B", but want to skip a line then grab the next 4 and paste them in the same column. How can I make this loop all of column "B" skipping every 5th line and change the range to the next open cell or "Range" automatically without manually typing each one individually? Range("B12:B16").Select Selection.Copy Sheets("Sheet2").Select Range("A2").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B18:B22").Select Selection.Copy Sheets("Sheet2").Select Range("A3").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True Range("B24:B28").Select Selection.Copy Sheets("Sheet2").Select Range("A4").Select Selection.PasteSpecial Paste:=xlPasteAll, Operation:=xlNone, SkipBlanks:= _ False, Transpose:=True

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 355 356 357 358 359 360 361 362 363 364 365 366  | Next Page >