Search Results

Search found 1105 results on 45 pages for 'pankaj kumar'.

Page 10/45 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Attending MySQL Connect? Your Opinion Matters.

    - by Monica Kumar
    Take the MySQL Connect 2012 Survey Thanks to everyone who is at the first ever MySQL Connect Conference in San Francisco this weekend! Don't forget to take your Conference and Session Surveys. Your opinions help shape next year's conference. Take a survey for each of the sessions you attend and be entered into a drawing for one prize for $200 American Express Gift Certificate. Fill in the daily conference survey and be entered into a drawing for one prize for a $500 American Express Gift Card Surveys are located here. Make your opinion count! Take the survey now. Congratulations to Robin Schumacher from DataStax as he is the winner of the Saturday survey!

    Read the article

  • How should I determine direction from a phone's orientation & accelerometer?

    - by Manoj Kumar
    I have an Android application which moves a ball based on the orientation of the phone. I've been using the following code to extract the data - but how do I use it to determine what direction the ball should actually travel in? public void onSensorChanged(int sensor, float[] values) { // TODO Auto-generated method stub synchronized (this) { Log.d("HIIIII :- ", "onSensorChanged: " + sensor + ", x: " + values[0] + ", y: " + values[1] + ", z: " + values[2]); if (sensor == SensorManager.SENSOR_ORIENTATION) { System.out.println("Orientation X: " + values[0]); System.out.println("Orientation Y: " + values[1]); System.out.println("Orientation Z: " + values[2]); } if (sensor == SensorManager.SENSOR_ACCELEROMETER) { System.out.println("Accel X: " + values[0]); System.out.println("Accel Y: " + values[1]); System.out.println("Accel Z: " + values[2]); } } }

    Read the article

  • Oracle Virtualization Friday Spotlight - November 8, 2013

    - by Monica Kumar
    Hands-on Private Cloud Simulator In One Hour Submitted by: Doan Nguyen, Senior Principal Product Marketing Director My aeronautics instructor used to say, "you can’t appreciate flying until you take flight." To clarify, this is not about gearing up in a flying squirrel suit and hopping off a cliff (topic for another blog!) but rather about flying an airplane. The idea is to get hands-on with the controls at the cockpit and experience flight before you actually fly a real plane. After the initial 40 hours of flight time, the concept sank in and it really made sense.This concept is what inspired our technical experts to put together the hands-on lab for a private cloud deployment and management self-service model. Yes, we are comparing the lab to a flight simulator! Let’s look at the parallels: To get trained to fly, starting in the simulator gets you off the ground quicker. There is no need to have a real plane to begin with. In a hands-on lab, there is no need for a real server, with networking and real storage installed. All you need is your laptop The simulator is pre-configured, pre-flight check done. Similarly, in a hands-on lab, Oracle VM and Oracle Enterprise Manager are pre-configured and assembled using Oracle VM VirtualBox as the container. Software installations are not needed. After time spent training at the controls, you can really appreciate the practical experience of flying. Along the same lines, the hands-on lab is a guided learning path, without the encumbrances of hardware, software installation, so you can learn about cloud deployment and management.  However, unlike the simulator training, your time investment with the lab is only about an hour and not 40 hours! This hands-on lab takes you through private cloud deployment and management using Oracle VM and  Oracle Enterprise Manager Cloud Control 12c in an Infrastructure as a service IaaS model. You will first configure the IaaS cloud as the cloud administrator and then deploy guest virtual machines (VMs) as a self-service user. Then you are ready to take flight into the cloud! Why not step into the cockpit now!

    Read the article

  • How do I get Catalyst 11.10 with ATI Radeon Mobility HD 5470 working on an HP DV7?

    - by S Kumar
    I have a HP DV7 with a HD 5470 512M card. Installation of the Catalyst 11.10 is repeatedly failing on a fresh install of Ubuntu 11.10. Catalyst 11.8 proprietary drivers were working well with Ubuntu 11.04. I have tried installing directly from the .run and generating the distribution specific packages. Nothing has worked. After installation which goes through successfully, the system hangs on reboot after the flashing dots. I have to replace the /etc/X11/xorg.conf to get the X working. I have followed instructions as per the http://wiki.cchtml.com/index.php/Main_Page wiki. Request for support to ATI/AMD gives the response that this model is unsupported on Linux by HP :). Updated 14-Nov I have reverted back to the open source drivers which work well enough for me.

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to set BackGround color to a divider in JSplitPane

    - by Sunil Kumar Sahoo
    I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

    Read the article

  • Facebook Application Tab On Page Not Working

    - by Pankaj Khurana
    Hi, I have a working facebook fbml application tab on a page. It was working perfectly but today when i checked it was generating an error. Errors while loading page from application Parse errors: FBML Error (line 18): illegal tag "body" under "fb:tab-position" FBML Error (line 26): illegal tag "noscript" under "fb:tab-position" FBML Error (line 44): illegal tag "noscript" under "fb:tab-position" Runtime errors: HTML error while rendering tag "link": There is a hard limit of 2 css link tags on profile tabs in order to remain under the IE 31 tag limit. HTML error while rendering tag "link": There is a hard limit of 2 css link tags on profile tabs in order to remain under the IE 31 tag limit. Cannot allow external script My settings are: Canvas Callback URL: http://mydomain/myfile/ Canvas URL: http://mydomain/myfeedback/ Tab Name: Feedback Tab URL: http://apps.facebook.com/myfeedback/ This is an fbml application without any body tags I am unable to find out the reason for the same. Please help me on this. Thanks

    Read the article

  • Write XML using best way(Linq To XML or other)

    - by Pankaj
    Hello All I want to write my xml with following format. How can i do it?I am using c# <map borderColor='c5e5b8' fillColor='6a9057' numberSuffix=' Mill.' includeValueInLabels='0' labelSepChar=': ' baseFontSize='9' showFCMenuItem='0' hoverColor='c2bc23' showTitle='0' type='0' showCanvasBorder='0' bgAlpha='0,0' hoveronEmpty='1' includeNameInLabels='0' showLabels='1'> <!--toolText='Alaska'imageSave='1' imageSaveURL='Path/FusionChartsSave.aspx or FusionChartsSave.php'--> <data> <entity id='AL' value='AL' link="JavaScript:FilterClientProjectList('AL');" fontBold='1' showLabel='0' /> <entity id='AK' value='AK' link="JavaScript:FilterClientProjectList('AK');" fontBold='1' hoverColor='6a9057'/> <entity id='AZ' value='AZ' link="JavaScript:FilterClientProjectList('AZ');" fontBold='1'/> </data> <styles> <definition> <style name='MyFirstFontStyle' type='font' face='Verdana' size='11' color='0372AB' bold='1' bgColor='FFFFFF' /> </definition> <application> <apply toObject='Labels' styles='' /> </application> </styles> </map> Thanks in advance..

    Read the article

  • Errorprovider shows error on using windows close button(X)

    - by Pankaj Kumar
    Hi guys, Is there any way to turn the damned error provider off when i try to close the form using the windows close button(X). It fires the validation and the user has to fill all the fields before he can close the form..this will be a usability issue because many tend to close the form using the (X) button. i have placed a button for cancel with causes validation to false and it also fires a validation. i found someone saying that if you use Form.Close() function validations are run... how can i get past this annoying feature. i have a MDI sturucture and show the form using CreateExam.MdiParent = Me CreateExam.Show() on the mdi parent's menuitem click and have this as set validation Private Sub TextBox1_Validating(ByVal sender As System.Object, ByVal e As System.ComponentModel.CancelEventArgs) Handles TextBox1.Validating If String.IsNullOrEmpty(TextBox1.Text) Then Err.SetError(TextBox1, "required") e.Cancel = True End If If TextBox1.Text.Contains("'") Then Err.SetError(TextBox1, "Invalid Char") e.Cancel = True End If End Sub Any help is much appreciated. googling only showed results where users were having problem using a command button as close button and that too is causing problem in my case

    Read the article

  • How do I create a UIViewController programmatically?

    - by pankaj
    I am working in a app where i have data in UITableView. It is like a drill down application. User will click on a row and will go to next page showing more records in a UITableView. But problem in my case is that i dont know upto how many level user can drill. The number of levels are not fixed. So now i am thinking to create and add the viewcontrollers programmatically. Is it possible?? if yes how? thanks in advance.

    Read the article

  • Problem in adding custom fields to django-registration

    - by Pankaj Singh
    I tried extending RegistrationFormUniqueEmail class CustomRegistrationFormUniqueEmail(RegistrationFormUniqueEmail): first_name = forms.CharField(label=_('First name'), max_length=30,required=True) last_name = forms.CharField(label=_('Last name'), max_length=30, required=True) def save(self, profile_callback=None): new_user = super(CustomRegistrationFormUniqueEmail, self).save(profile_callback=profile_callback) new_user.first_name = self.cleaned_data['first_name'] new_user.last_name = self.cleaned_data['last_name'] return new_user then changing view # form = form_class(data=request.POST, files=request.FILES) form = CustomRegistrationFormUniqueEmail(data=request.POST, files=request.FILES) but still I am seeing default view containg four fields only .. help is needed

    Read the article

  • parsing xml data from a google api

    - by pankaj
    Hi, i have a google map link which returns a xml to me. I want values of a specific tag from that xml. can some one suggest me how will i do it. Link: http://maps.google.com/maps/api/geocode/xml?address=1270 Broadway Ste 803, New York, NY 10001, USA&sensor=false

    Read the article

  • assembly is not loading in setup Project.

    - by Pankaj Mishra
    I have window service an i want to install this in into my local system. But when I am trying to make setup file that time i have added Project output and it adds two dll file automatically. and error comes when i build that project setup. i Google lot of time and try lot of ideas then i got problem that Assembly is not loading. how can i resolve that problem. Please help me for this.

    Read the article

  • Show loading image when pdf rendering

    - by Pankaj
    I am displaying pdf on my page like this <object data="/Customer/GetPricedMaterialPDF?projID=<%= ViewData["ProjectID"]%>" type="application/pdf" width="960" height="900" style="margin-top: -33px;"> <p> It appears you don't have a PDF plugin for this browser. No biggie... you can <a href="/Customer/GetPricedMaterialPDF?projID=<%= ViewData["ProjectID"]%>">click here to download the PDF file. </a> </p> </object> and Controller function are public FileStreamResult GetPricedMaterialPDF(string projID) { System.IO.Stream fileStream = GeneratePDF(projID); HttpContext.Response.AddHeader("content-disposition", "attachment; filename=form.pdf"); return new FileStreamResult(fileStream, "application/pdf"); } private System.IO.Stream GeneratePDF(string projID) { //create your pdf and put it into the stream... pdf variable below //comes from a class I use to write content to PDF files System.IO.MemoryStream ms = new System.IO.MemoryStream(); Project proj = GetProject(projID); List<File> ff = proj.GetFiles(Project_Thin.Folders.IntegrationFiles, true); string fileName = string.Empty; if (ff != null && ff.Count > 0 && ff.Where(p => p.AccessToUserID == CurrentCustomer.CustomerID).Count() > 0) { ff = ff.Where(p => p.AccessToUserID == CurrentCustomer.CustomerID).ToList(); foreach (var item in ff) { fileName = item.FileName; } byte[] bArr = new byte[] { }; bArr = GetJDLFile(fileName); ms.Write(bArr, 0, bArr.Length); ms.Position = 0; } return ms; } Now my problem is function on controller taking 10 to 20 second to process pdf, data="/Customer/GetPricedMaterialPDF?projID=<%= ViewData["ProjectID"]%>" at that time my page shows blank, which i don't want. i want to show loading image at that time. How can i do this...

    Read the article

  • Pass object using JSON

    - by Pankaj
    Hello All right now i am using Json for passing status and message like return Json(new { Success = true, Message = "Save successfully" }); Project model=new Project() Is there any way, i can send model in json also? I am using c# and asp.net mvc

    Read the article

  • How to add data manually in core data entity

    - by pankaj
    Hi I am working on core data for the first time. I have just created an entity and attributes for that entity. I want to add some data inside the entity(u can say i want to add data in a table), earlier i when i was using sqlite, i would add data using terminal. But here in core data i am not able to find a place where i can manually add data. I just want to add data in entity and display it in a UITableView. I have gone through the the documentation of core data but it does not explain how to add data manually although it explains how i can add it programmiticaly but i dont need to do it programically. I want to do it manually. Thanks in advance

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • window.print() not working in IE

    - by Pankaj
    I am doing something like this in javascript to print a section of my page on click of a link function printDiv() { var divToPrint = document.getElementById('printArea'); newWin= window.open(); newWin.document.write(divToPrint.innerHTML); newWin.print(); newWin.close(); } It works great in Firefox but not in IE. Could someone please help

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >