Search Results

Search found 1055 results on 43 pages for 'sunil kumar sahoo'.

Page 10/43 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Attending MySQL Connect? Your Opinion Matters.

    - by Monica Kumar
    Take the MySQL Connect 2012 Survey Thanks to everyone who is at the first ever MySQL Connect Conference in San Francisco this weekend! Don't forget to take your Conference and Session Surveys. Your opinions help shape next year's conference. Take a survey for each of the sessions you attend and be entered into a drawing for one prize for $200 American Express Gift Certificate. Fill in the daily conference survey and be entered into a drawing for one prize for a $500 American Express Gift Card Surveys are located here. Make your opinion count! Take the survey now. Congratulations to Robin Schumacher from DataStax as he is the winner of the Saturday survey!

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • Login Using HtmlUnit

    - by Sunil
    Hello I am using HtmlUnit to login into the page. I got the userid amd password field and also the submit button .The type of submit button is image . and I fill the userid and password field with values and when I click the button i is unable to login. Thanks in advance.

    Read the article

  • How to get Cookies using HttpClient

    - by Sunil
    Hello I am using HttpClient to get Cookies but I am unable find any cookies.My Code is given below public class LoginTab { private Cookie[] cookies; HttpClient httpClient; HttpState httpState; HashMap postData; public LoginTab() { httpClient = new HttpClient(); httpState = new HttpState(); httpClient.getHttpConnectionManager(). getParams().setConnectionTimeout(300000); httpClient.setState(httpState); // RFC 2101 cookie management spec is used per default // to parse, validate, format & match cookies httpClient.getParams().setCookiePolicy(CookiePolicy.RFC_2109); postData= new HashMap(); } public String getMethod(String url) { GetMethod getMethod = new GetMethod(url); String pageSoure=""; try{ httpClient.executeMethod(getMethod); pageSoure=getMethod.getResponseBodyAsString(); extractUsefulPostData(pageSoure, postData); getMethod.releaseConnection(); }catch(Exception ex) { ex.printStackTrace(); } return pageSoure; } public static void main(String[]arg) { LoginTab loginTab= new LoginTab(); System.out.println(loginTab.getMethod("http://tab.com.au/")); Cookie [] cookies=loginTab.httpState.getCookies(); System.out.println(cookies.length); for(int i=0;i<cookies.length;i++) System.out.println(cookies[i]); } } Please suggest me where is the mistake. Thanks in advance

    Read the article

  • How to get Cookies using HttpClient

    - by Sunil
    Hello I am using HttpClient to get Cookies but I am unable find any cookies.My Code is given below public class LoginTab { private Cookie[] cookies; HttpClient httpClient; HttpState httpState; HashMap postData; public LoginTab() { httpClient = new HttpClient(); httpState = new HttpState(); httpClient.getHttpConnectionManager(). getParams().setConnectionTimeout(300000); httpClient.setState(httpState); // RFC 2101 cookie management spec is used per default // to parse, validate, format & match cookies httpClient.getParams().setCookiePolicy(CookiePolicy.RFC_2109); postData= new HashMap(); } public String getMethod(String url) { GetMethod getMethod = new GetMethod(url); String pageSoure=""; try{ httpClient.executeMethod(getMethod); pageSoure=getMethod.getResponseBodyAsString(); extractUsefulPostData(pageSoure, postData); getMethod.releaseConnection(); }catch(Exception ex) { ex.printStackTrace(); } return pageSoure; } public static void main(String[]arg) { LoginTab loginTab= new LoginTab(); System.out.println(loginTab.getMethod("http://tab.com.au/")); Cookie [] cookies=loginTab.httpState.getCookies(); System.out.println(cookies.length); for(int i=0;i<cookies.length;i++) System.out.println(cookies[i]); } } Please suggest me where is the mistake. Thanks in advance

    Read the article

  • Serial Port Not getting closed. I want to release the COM port ...

    - by sunil
    Serial Port Not getting closed. I want to release the COM port ... Below is my code.... import java.io.*; import java.util.*; import gnu.io.*; public class ReadCommPort implements SerialPortEventListener { static CommPortIdentifier portId; static Enumeration portList; InputStream inputStream; OutputStream outputStream; public SerialPort serialPort; List byteList = new ArrayList(); public static Message message = null; public void readData() { boolean portFound = false; String defaultPort = "COM1"; portList = CommPortIdentifier.getPortIdentifiers(); while ( portList.hasMoreElements() ) { portId = ( CommPortIdentifier )portList.nextElement(); if ( portId.getPortType() == CommPortIdentifier.PORT_SERIAL ) { if ( portId.getName().equals( defaultPort ) ) { System.out.println( "Found port: " + defaultPort ); portFound = true; buildSerialPort(); } } } if ( ! portFound ) { System.out.println( "port " + defaultPort + " not found." ); } } public void buildSerialPort() { try { serialPort = (SerialPort) portId.open( "ReadCommPort", 1 ); inputStream = serialPort.getInputStream(); outputStream = serialPort.getOutputStream(); serialPort.addEventListener( this ); serialPort.notifyOnDataAvailable(true); serialPort.setSerialPortParams( 2400, SerialPort.DATABITS_7, SerialPort.STOPBITS_1, SerialPort.PARITY_NONE ); } catch ( Exception e ) { e.printStackTrace(); } } @SuppressWarnings("unchecked") public void serialEvent( SerialPortEvent event ) { switch ( event.getEventType() ) { case SerialPortEvent.BI: System.out.println( "BI"); break; case SerialPortEvent.OE: System.out.println( "OE"); break; case SerialPortEvent.FE: System.out.println( "FE"); break; case SerialPortEvent.PE: System.out.println( "PE"); break; case SerialPortEvent.CD: System.out.println( "CD"); break; case SerialPortEvent.CTS: System.out.println( "CTS"); break; case SerialPortEvent.DSR: System.out.println( "DSR"); break; case SerialPortEvent.RI: System.out.println( "RI"); break; case SerialPortEvent.OUTPUT_BUFFER_EMPTY: System.out.println( "OUTPUT_BUFFER_EMPTY"); break; case SerialPortEvent.DATA_AVAILABLE : try { int len = inputStream.available(); byte[] readBuffer = new byte[ len ]; // processing data code.. // close the port // release all resources... serialPort.removeEventListener(); try { serialPort.addEventListener( null ); } catch (TooManyListenersException e) { e.printStackTrace(); } inputStream.close(); outputStream.close(); serialPort.close(); } catch ( IOException e ) { e.printStackTrace(); } break; } } public static void main(String[] args) { new ReadCommPort().readData(); } }

    Read the article

  • Random number Generator in C#

    - by Sunil
    Why do i need to create an instance of Random class, if i want to create a random number between 1 and 100 ....like Random rand = new Random(); rand.Next(1,100); Is there any static function of Random class to do the same? like... Random.Next(1,100); I don't want to create an instance unnecessarily

    Read the article

  • Very Simple Regex Question

    - by Sunil
    Hello sir I have a very simple regex question suppose I have 2 condition 1 url =http://www.abc.com/cde/def 2 url =https://www.abc.com/sadfl/dsaf and how can I extract the baseUrl using regex. sample output 1 http://www.abc.com 2 https://www.abc.com Thanks

    Read the article

  • Facebook events api: Event member (FQL)

    - by sunil-khedar
    I am fetching the event members for facebook events. Till yesterday I was getting the proper counts of members of an event. But suddenly the counts have following issues: For lot of plans on every consecutive request, I am getting random number of members. Strange issue. Seems facebook servers are not synced properly or something similar. Earlier for the same query string (mentioned below), I was getting the correct counts. But now the count is much less. It seems that at least for a few events now they are sending only the members who are connected with our application (we are using facebook connect). Example: for the following query currently I am getting "31" members. But on event page members count is much more. FQL: FB.Facebook.apiClient.fql_query('SELECT uid, eid, rsvp_status FROM event_member WHERE eid=336671213618', function(result, error){alert(result.length);}); Event page: http://www.facebook.com/event.php?eid=109411842404023 Is there any recent change in facebook API or policies? Thanks in advance.

    Read the article

  • WCF Service in Azure with ClaimsIdentity over SSL

    - by Sunil Ramu
    Hello , Created a WCF service as a WebRole using Azure and a client windows application which refers to this service. The Cloud Service is refered to a certificate which is created using the "Hands On Lab" given in windows identity foundation. The Web Service is hosted in IIS and it works perfect when executed. I've created a client windows app which refers to this web service. Since WIF Claims identity is used, I have a claimsAuthorizationManager Class, and also a Policy class with set of defilned policies. The Claims is set in the web.config file. When I execute the windows app as the start up project, the app prompts for authentication, and when the account credentials are given as in the config file, it opens a new "Windows Card Space" Window and Says "Incoming Policy Failed". When I close the window the System throws and Exception The incoming policy could not be validated. For more information, please see the event log. Event Log Details Incoming policy failed validation. No valid claim elements were found in the policy XML. Additional Information: at System.Environment.get_StackTrace() at Microsoft.InfoCards.Diagnostics.InfoCardTrace.BuildMessage(InfoCardBaseException ie) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.TraceAndLogException(Exception e) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.ThrowHelperError(Exception e) at Microsoft.InfoCards.InfoCardPolicy.Validate() at Microsoft.InfoCards.Request.PreProcessRequest() at Microsoft.InfoCards.ClientUIRequest.PreProcessRequest() at Microsoft.InfoCards.Request.DoProcessRequest(String& extendedMessage) at Microsoft.InfoCards.RequestFactory.ProcessNewRequest(Int32 parentRequestHandle, IntPtr rpcHandle, IntPtr inArgs, IntPtr& outArgs) Details: System Provider [ Name] CardSpace 3.0.0.0 EventID 267 [ Qualifiers] 49157 Level 2 Task 1 Keywords 0x80000000000000 EventRecordID 6996 Channel Application EventData No valid claim elements were found in the policy XML. Additional Information: at System.Environment.get_StackTrace() at Microsoft.InfoCards.Diagnostics.InfoCardTrace.BuildMessage(InfoCardBaseException ie) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.TraceAndLogException(Exception e) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.ThrowHelperError(Exception e) at Microsoft.InfoCards.InfoCardPolicy.Validate() at Microsoft.InfoCards.Request.PreProcessRequest() at Microsoft.InfoCards.ClientUIRequest.PreProcessRequest() at Microsoft.InfoCards.Request.DoProcessRequest(String& extendedMessage) at Microsoft.InfoCards.RequestFactory.ProcessNewRequest(Int32 parentRequestHandle, IntPtr rpcHandle, IntPtr inArgs, IntPtr& outArgs)

    Read the article

  • Iphone web application

    - by Sunil
    Hi All, I am developing a iphone web application. I already have a website designed using php and mysql. how I can convert this website to compatile for iphone. pls share your thoughts. Thanks

    Read the article

  • regex split problem

    - by sunil-mand99
    I have javascript string variable with var sttr="We prefer questions that can be answered --------------------- not just discussed --------------------- Provide details ---------------------------- Write clearly and simply --------------------------answer all the question" please suggest how to split the string into array of sentences on the basis of dashes(-----) using regex result should be array[0]=We prefer questions that can be answered array[1]=not just discussed array[2]=Provide details array[3]=rite clearly and simply array[4]=answer all the question Note: dash(-----) range after each sentence is between 10 to 50

    Read the article

  • END_TAG exception while calling WCF WebService from Android using KSOAP2?

    - by sunil
    Hi, I am trying to call a WCF Web Service from Android using KSOAP2 library. But I am getting this END_TAG exception. I have followed this thread to call WCF Web Service but still no result. I am passing "urn:TestingWcf/GetNames" as SOAP_ACTION, does this causes problem in Android since the error occurs at the statement "aht.call(SOAP_ACTION, envelope)" where aht is AndroidHttpTransport class object. Can someone let me know what the problem may be? import org.ksoap2.*; import org.ksoap2.serialization.*; import org.ksoap2.transport.*; import android.app.Activity; import android.os.Bundle; import android.widget.TextView; public class Ksoap2Test extends Activity { private static final String METHOD_NAME = "GetNamesJsonWithParam" private static final String NAMESPACE = "http://tempuri.org/"; private static final String URL = "http://192.168.3.61/BattleEmpire.Service/TestingWcf.svc/basic"; final String SOAP_ACTION = "urn:TestingWcf/GetNamesJsonWithParam"; TextView tv; StringBuilder sb; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); tv = new TextView(this); sb = new StringBuilder(); call(); tv.setText(sb.toString()); setContentView(tv); } public void call() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); request.addProperty("imran", "Qing"); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); System.out.println("Request " + envelope.toString()); //HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); AndroidHttpTransport aht = new AndroidHttpTransport(URL); aht.call(SOAP_ACTION, envelope); //aht.debug = true; /*HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); androidHttpTransport.call(SOAP_ACTION, envelope);*/ SoapPrimitive result = (SoapPrimitive)envelope.getResponse(); //to get the data String resultData = result.toString(); // 0 is the first object of data sb.append(resultData + "\n"); SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; System.out.println(resultsRequestSOAP.toString()); } catch (Exception e) { e.printStackTrace(); sb.append("Error:\n" + e.getMessage() + "\n"); } } } `

    Read the article

  • Regular Expression in java

    - by Sunil
    I have a HTML page and I want to fetch the result between two tags <b> and <BR> <b>Defendants Name:</b>Donahue, Leah A <BR> What is the regular expression to fetch the words between these two tags

    Read the article

  • Machine restricted login access

    - by Sunil Shenoy
    I am working on a project that has a requirement such that login details can only be accessed from one machine at one time. For example, if I grant you access to my website and you login from your home machine, the system will store this settings in a cookie/database. Now if you try the same login details on your work machine or any other machine, the system will not let you log into the system. The login will now only work from home machine. Any suggestions on how to achieve this would be helpful. Any resources you can point me towards would also be appreciated.

    Read the article

  • lucene query issue

    - by Sunil
    I am using Lucene with Alfresco. Here is my query: ( TYPE:"{com.company.customised.content.model}test" && (@\{com.company.customised.content.model\}testNo:111 && (@\{com.company.customised.content.model\}skill:or)) I have to search documents which are having property skill of value "or". The above query is not giving any results (I am getting failed to parse query). If I use the query up until testNo (ignoring skill), I am getting proper results: ( TYPE:"{com.company.customised.content.model}test" && (@\{com.company.customised.content.model\}testNo:111)) Can you please help me? Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to Show detail section only with out any space in Active Report

    - by Sunil Naudiyal
    i have a active report without any Page Header , Report Header and no any Footer type section. for more detail see attached image. Now issue is that When we run this report we got space before report detail. for more detail see attached image Below is my code Assembly asm = Assembly.GetAssembly(this.GetType()); System.IO.Stream stre = asm.GetManifestResourceStream(asm.GetName().Name + ".CoverPage.rpx"); using (XmlTextReader xr = new XmlTextReader(stre)) { arCoverPage.LoadLayout(xr); } //Get detail for Cover Page AddingReportSection(report, HeaderType.CoverPage); arCoverPage.DataSource = lstCoverPage; arCoverPage.Run(); I want remove this space.so please give me any suggestion/idea I also tried to set height of page but i am not get sucess. arCoverPage.PageSettings.DefaultPaperSize = false; arCoverPage.PageSettings.Gutter = 3.0F; arCoverPage.PageSettings.Orientation = DataDynamics.ActiveReports.Document.PageOrientation.Portrait; arCoverPage.PageSettings.PaperHeight = 5.0F; this.viReport.Document = arCoverPage.Document;

    Read the article

  • URL rewriting to a common end point

    - by sunil
    I want to create an asp.net white-label site http://whitelabel.com, that could be styled for each of our clients according to their specific needs. So for example, client abc would see the site in their corporate colours and be accessed through their specific url http://abc.com. Likewise client xyz would see the site in their own styling and url http://xyz.com. Typing either url, in effect, takes the user to http://whitelabel.com where the styling is applied, and the client's url structure is retained. I was thinking of URL rewriting using URLRewriter.Net (http://urlrewriter.net/), or similar, mapping the incoming address to a client id and applying the theme accordingly. So, a url rewrite rule may be something like <rewrite url="http//abc.com/(.+)" to="~/$1?id=1" /> <rewrite url="http//xyz.com/(.+)" to="~/$1?id=2" /> I could then read the id, map it to the client, and with a bit of jiggery-pokery, apply the correct theme. I was wondering if: this is the right approach ? I've overlooked something ? there is a better way to do this ? Any suggestions would be appreciated.

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >