Search Results

Search found 1065 results on 43 pages for 'suresh kumar'.

Page 10/43 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Reliable UDP

    - by suresh
    How can I develop a Linux kernel module in order to make UDP reliable? This is my college assignment and I don't how to proceed. how to do change the default UDP behaviour in linux kernel by loading a new kernel module? and how to program such kernel module?

    Read the article

  • How to design a RESTful collection resource?

    - by Suresh Kumar
    I am trying to design a "collection of items" resource. I need to support the following operations: Create the collection Remove the collection Add a single item to the collection Add multiple items to the collection Remove a single item from the collection Remove multiple items from the collection This is as far as I have gone: Create collection: ==> POST /service Host: www.myserver.com Content-Type: application/xml <collection name="items"> <item href="item1"/> <item href="item2"/> <item href="item3"/> </collection> <== 201 Created Location: http://myserver.com/service/items Content-Type: application/xml ... Remove collection: ==> DELETE /service/items <== 200 OK Removing a single item from the collection: ==> DELETE /service/items/item1 <== 200 OK However, I am finding supporting the other operations a bit tricky i.e. what methods can I use to: Add single or multiple items to the collection. (PUT doesn't seem to be right here as per HTTP 1.1 RFC Remove multiple items from the collection in one transaction. (DELETE doesn't seem to right here either)

    Read the article

  • Port android / android tv on nokia booklet 3G

    - by Suresh
    is it possible to port android (android tv) on Nokia booklet 3G , i like the booklet hardware (built in 3g modem and hdmi port and overall build) but windows 7 is horrible. it would be great to have android with android tv port on nokia booklet 3G any idea how to do?

    Read the article

  • Criteria for selecting software for embedded device

    - by Suresh Kumar
    We are currently evaluating Web servers for an embedded device. We have laid down the evaluation criteria for things like HTTP version, Security, Compression etc. On the embeddable side, we have identified the following criteria: Memory footprint Memory management (support for plugging in a custom memory manager) CPU usage Thread usage (support for thread pool) Portability What I want inputs on is: Are there any other criteria that an embeddable software should meet? What exactly does it mean when someone says that a software is designed for embeddable use? We currently have zeroed in on two Web servers: AppWeb Lighttpd (lighty) Feature wise, both the above Web servers seem to be on par. However, it is claimed that AppWeb is designed for embedded use while Lighttpd is not. To choose between the above two Web servers, what criteria should I be looking at?

    Read the article

  • get location(lat/long) without gps just like my location feature of google maps

    - by Suriyan Suresh
    Get location(lat/long) without GPS, just like my location feature in Google maps. I have Google Maps in my mobile (Sony Ericsson G502 without GPS). It works fine without GPS in India. 1.How Google finds my position? 2. When i am searching cellid in opencellid database, it has less number of records for India. but Google Maps works fine in my mobile(India) 3.Is Google uses opencellid database or its own?. if Google uses its own, shall we have access to it database

    Read the article

  • Image library for mobile application

    - by Suriyan Suresh
    I need a C/C++ image library for mobile image application, The library should have Brightness/contrast Levels Effects - Grayscale, Sepia and so on I particularly want to use it on Samsung BADA Platform. I want the the one event hough if it is not optimized for BADA, i will do the rest.

    Read the article

  • List all the months using oracle sql .

    - by Suresh S
    Guys is there any better way to list all the months other than this select to_char(add_months(to_date('01/01/1000', 'DD/MM/RRRR'), ind.l-1), 'MONTH') as month_descr , ind.l as month_ind from dual descr , ( select l from (select level l from dual connect by level <= 12) ) ind order by 2; ANSWER : SELECT to_char(add_months(SYSDATE, (LEVEL-1 )),'MONTH') as months FROM dual CONNECT BY LEVEL <= 12

    Read the article

  • GZIP .htaccess and php session problem

    - by Suresh
    Hi, I am trying to implement GZIP compression for my website. I copied the below code in my .htaccess file: ExpiresActive On ExpiresDefault A604800 Header append Cache-Control "public" <IfModule mod_deflate.c> <FilesMatch "\.(js|css)$"> SetOutputFilter DEFLATE </FilesMatch> </IfModule> what happens is when I type username and password the page reloads but still the login form is displayed but session is set. When I refresh the page using ctrl + R the login form goes and the username is displayed. what will be the problem. wwaiting for ur reply.

    Read the article

  • Oracle Sql Query taking a day long to return results using dblink

    - by Suresh S
    Guys i have the following oracle sql query that gives me the monthwise report between the dates. Basically for nov month i want sum of values between the dates 01nov to 30 nov. The table tha is being queried is residing in another database and accesssed using dblink. The DT columns is of NUMBER type (for ex 20101201) .The execution of the query is taking a day long and not completed. kindly suggest me , if their is any optimisation that can be suggested to my DBA on the dblink, or any tuning that can be done on the query , or rewriting the same. SELECT /*+ PARALLEL (A 8) */ TO_CHAR(TRUNC(TRUNC(SYSDATE,'MM')- 1,'MM'),'MONYYYY') "MONTH", TYPE AS "TYPE", COLUMN, COUNT (DISTINCT A) AS "A_COUNT", COUNT (COLUMN) AS NO_OF_COLS, SUM (DURATION) AS "SUM_DURATION", SUM (COST) AS "COST" FROM **A@LN_PROD A** WHERE DT >=TO_NUMBER(TO_CHAR(TRUNC(TRUNC(SYSDATE,'MM')-1,'MM'),'YYYYMMDD')) AND DT < TO_NUMBER(TO_CHAR(TRUNC(TRUNC(SYSDATE,'MM'),'MM'),'YYYYMMDD')) GROUP BY TYPE, COLUMN

    Read the article

  • Monitoring GPS Coordinates

    - by Suriyan Suresh
    I need to monitor GPS Coordinates changes at every 15 min and take action based on that. as per bada developer guide report "only one application allowed to run at a time if another application try to run first one is closed" .so that how do i monitor GPS coordinates without interruption from other applications. how do i keep my application running at all times

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >