Search Results

Search found 5885 results on 236 pages for 'inline pdf'.

Page 100/236 | < Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >

  • Can't update textbox in TinyMCE

    - by Michael Tot Korsgaard
    I'm using TinyMCE, the text area is replaced with a TextBox, but when I try to update the database with the new text from my textbox, it wont update. Can anyone help me? My code looks like this <%@ Page Title="" Language="C#" MasterPageFile="~/Main.Master" AutoEventWireup="true" CodeBehind="default.aspx.cs" Inherits="Test_TinyMCE._default" ValidateRequest="false" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" runat="server"> <script src="JavaScript/tiny_mce/tiny_mce.js" type="text/javascript"></script> <script type="text/javascript"> tinyMCE.init({ // General options mode: "textareas", theme: "advanced", plugins: "pagebreak,style,layer,table,save,advhr,advimage,advlink,emotions,iespell,insertdatetime,pre view,media,searchreplace,print,contextmenu,paste,directionality,fullscreen,noneditable,visualchars,no nbreaking,xhtmlxtras,template,wordcount,advlist,autosave", // Theme options theme_advanced_buttons1: "save,newdocument,|,bold,italic,underline,strikethrough,|,justifyleft,justifycenter,justifyright,justifyfull,styleselect,formatselect,fontselect,fontsizeselect", theme_advanced_buttons2: "cut,copy,paste,pastetext,pasteword,|,search,replace,|,bullist,numlist,|,outdent,indent,blockquote,|,undo,redo,|,link,unlink,anchor,image,cleanup,help,code,|,insertdate,inserttime,preview,|,forecolor,backcolor", theme_advanced_buttons3: "tablecontrols,|,hr,removeformat,visualaid,|,sub,sup,|,charmap,emotions,iespell,media,advhr,|,print,|,ltr,rtl,|,fullscreen", theme_advanced_buttons4: "insertlayer,moveforward,movebackward,absolute,|,styleprops,|,cite,abbr,acronym,del,ins,attribs,|,visualchars,nonbreaking,template,pagebreak,restoredraft", theme_advanced_toolbar_location: "top", theme_advanced_toolbar_align: "left", theme_advanced_statusbar_location: "bottom", theme_advanced_resizing: true, // Example content CSS (should be your site CSS) // using false to ensure that the default browser settings are used for best Accessibility // ACCESSIBILITY SETTINGS content_css: false, // Use browser preferred colors for dialogs. browser_preferred_colors: true, detect_highcontrast: true, // Drop lists for link/image/media/template dialogs template_external_list_url: "lists/template_list.js", external_link_list_url: "lists/link_list.js", external_image_list_url: "lists/image_list.js", media_external_list_url: "lists/media_list.js", // Style formats style_formats: [ { title: 'Bold text', inline: 'b' }, { title: 'Red text', inline: 'span', styles: { color: '#ff0000'} }, { title: 'Red header', block: 'h1', styles: { color: '#ff0000'} }, { title: 'Example 1', inline: 'span', classes: 'example1' }, { title: 'Example 2', inline: 'span', classes: 'example2' }, { title: 'Table styles' }, { title: 'Table row 1', selector: 'tr', classes: 'tablerow1' } ], // Replace values for the template plugin template_replace_values: { username: "Some User", staffid: "991234" } }); </script> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder1" runat="server"> <div> <asp:TextBox ID="TextBox1" runat="server" TextMode="MultiLine"></asp:TextBox> <br /> <asp:LinkButton ID="LinkButton1" runat="server" onclick="LinkButton1_Click">Update</asp:LinkButton> </div> </asp:Content> My codebhind looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Web.UI; using System.Web.UI.WebControls; namespace Test_TinyMCE { public partial class _default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { TextBox1.Text = Database.GetFirst().Text; } protected void LinkButton1_Click(object sender, EventArgs e) { Database.Update(Database.GetFirst().ID, TextBox1.Text); TextBox1.Text = Database.GetFirst().Text; } } } And finally the "Database" class im using looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Configuration; using System.Data.SqlClient; namespace Test_TinyMCE { public class Database { public int ID { get; set; } public string Text { get; set; } public static void Update(int ID, string Text) { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Update Text set Text=@text where ID=@id"); command.Connection = connection; command.Parameters.Add(new SqlParameter("id", ID)); command.Parameters.Add(new SqlParameter("text", Text)); command.ExecuteNonQuery(); } finally { connection.Close(); } } public static Database GetFirst() { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Select Top 1 ID, Text from Text order by ID asc"); command.Connection = connection; SqlDataReader reader = command.ExecuteReader(); if (reader.Read()) { Database item = new Database(); item.ID = reader.GetInt32(0); item.Text = reader.GetString(1); return item; } else { return null; } } finally { connection.Close(); } } } } I really hope that someone out there can help me

    Read the article

  • Win XP error 0x80041003 using GetObject/winmgmts

    - by John Lewis
    My computer is called "neil" and I want to set some values using WMI in vbScript. I adapetd the script below from one supplied by Microsoft. When I run it in my browser I get Error Type: (0x80041003) /dressage/30/pdf2.asp, line 8 I suspect it is some registry/security setting. Any advice? John Lewis FULL SCRIPT call Print_HTML_Page("http://neil/dressage/ascii.asp", "ascii") Sub SetPDFFile(strPDFFile) Const HKEY_LOCAL_MACHINE = &H80000002 strKeyPath = "SOFTWARE\Dane Prairie Systems\Win2PDF" strComputer = "." Set objReg=GetObject( _ "winmgmts:{impersonationLevel=impersonate}!\\" & _ strComputer & "\root\default:StdRegProv") strValueName = "PDFFileName" objReg.SetExpandedStringValue HKEY_LOCAL_MACHINE,_ strKeyPath,strValueName,strPDFFile End Sub Sub Print_HTML_Page(strPathToPage, strPDFFile) SetPDFFile( strPDFFile ) Set objIE = CreateObject("InternetExplorer.Application") 'From http://www.tek-tips.com/viewthread.cfm?qid=1092473&page=5 On Error Resume Next strPrintStatus = objIE.QueryStatusWB(6) If Err.Number 0 Then MsgBox "Cannot find a printer. Operation aborted." objIE.Quit Set objIE = Nothing Exit Sub End If With objIE .visible=0 .left=200 .top=200 .height=400 .width=400 .menubar=0 .toolbar=1 .statusBar=0 .navigate strPathToPage End With 'Wait until IE has finished loading Do while objIE.busy WScript.Sleep 100 Loop On Error Goto 0 objIE.ExecWB 6,2 'Wait until IE has finished printing WScript.Sleep 2000 objIE.Quit Set objIE = Nothing End Sub Update: Thanks for your reply. The line breaks seem to have been introduced in the process of paasting into this form. Well spotted - I was using a PDF file name "ascii". I added a .pdf extension but still get the error. I suspect you're right that it's to do with admin rights. Here's more about the setup and what I'm trying to achieve. Win2pdf is a product for writing PDFs by works by simulating a Windows printer. You "print" the page, select win2pdf in the print dialog and it then asks for a file name. I have it installed on my pc (called Neil) and it works fine in this conventional way. My aim is to write an html page to a PDF file using win2pdf - but via ASP/vbscript/javascript rather than with manual intervention. The script for doing this was provided by win2PDF's tech support but when it did not work, that was the limit of their understanding. In the sample script the file ascii.asp just produces a table of ascii codes/characters. The URL given is on my own PC which has IIS set up to run scripts which it does fine. The error I get occurs on about the fourth line executed. I am logged in with full admin rights - I think! But I'm no expert. I hope this helps to give some more specific suggestions about how to check/fix the admin rights.

    Read the article

  • JQGrid and JQuery Autocomplete

    - by Neff
    When implementing JQGrid 4.3.0, Jquery 1.6.2, and JQuery UI 1.8.16 Ive come across an issue with the Inline edit. When the inline edit is activated, some of the elements get assigned an auto complete. When the inline edit is canceld or saved, the auto complete does not always go away (selecting text by double clicking it then hitting delete, then hitting escape to exit row edit). Leaving the auto complete controls in edit mode when the row is no longer considered in edit mode. Perhaps you can tell me if there is a problem with the initialization or if I you are aware of an event post-"afterrestorefunc" that the fields can be returned to their "original" state. Original state being displayed as data in the JQGrid row. I've tried removing the DOM after row close, .remove() and .empty(): ... "afterrestorefunc": function(){ $('.ui-autocomplete-input').remove(); } ... but that causes other issues, such as the jqgrid is not able to find the cell when serializing the row for data or edit, and requires a refresh of the page, not just jqgrid, to be able to once again see the data from that row. Auto complete functionality for the element is created on the double click of the row: function CreateCustomSearchElement(value, options, selectiontype) { ... var el; el = document.createElement("input"); ... $(el).autocomplete({ source: function (request, response) { $.ajax({ url: '<%=ResolveUrl("~/Services/AutoCompleteService.asmx/GetAutoCompleteResponse") %>', data: "{ 'prefixText': '" + request.term + "', 'contextKey': '" + options.name + "'}", dataType: "json", type: "POST", contentType: "application/json; charset=utf-8", success: function (data) { response($.map(data.d, function (item) { return { label: Trim(item), value: Trim(item), searchVal: Trim(item) } })) } }); }, select: function (e, item) { //Select is on the event of selection where the value and label have already been determined. }, minLength: 1, change: function (event, ui) { //if the active element was not the search button //... } }).keyup(function (e) { if (e.keyCode == 8 || e.keyCode == 46) { //If the user hits backspace or delete, check the value of the textbox before setting the searchValue //... } }).keydown(function (e) { //if keycode is enter key and there is a value, you need to validate the data through select or change(onblur) if (e.keyCode == '13' && ($(el).val())) { return false; } if (e.keyCode == '220') { return false } }); } Other Sources: http://www.trirand.com/jqgridwiki/doku.php?id=wiki:inline_editing http://api.jqueryui.com/autocomplete/ Update: I tried only creating the autocomplete when the element was focused, and removing it when onblur. That did not resolve the issue either. It seems to just need the autocomplete dropdown to be triggered.

    Read the article

  • Open Microsoft Publisher Document on Linux

    - by Peter
    I'm pretty sure the options consist of Just don't do it (use a nice open standard file format). Not great when someone sends you something. Translate the format on Windows. I think you need Publisher, the viewer won't even print. But you can download a trial version for a once off (been there, done that). Submit the file for online translation to PDF. www.pdfonline.com/convert-pdf/ Use a Windows VM, wine, crossover office, Win4Lin, or otherwise run Publisher "under" linux. What I really want to do is convert it to something nicer natively under Linux.

    Read the article

  • Word is ignoring my 'Match Destination Formatting' preference when pasting text

    - by CreeDorofl
    I'm stuck using word 2007 at the office. It has options for retaining formatting, pasting as plain text, and pasting text to match the destination's formatting. That last option is the one I want, but word is blatantly ignoring it. I copy some text from a PDF, paste into word, and it retains the PDF's formatting... even though I went into options -- advanced -- changed all the dropdowns to "Match Destination Formatting". It also ignores "text only" option... It retains the exact mix of bold, italic, normal text & fonts. I can work around it by pasting to a plain text file, then pasting into word. Or I can do paste special -- unformatted text. But this is so irritating... I just want to ctrl+V and not hassle with it every single time. Is there a better fix?

    Read the article

  • Turn off enclosing <p> tags in CKEditor 3.0

    - by Kosi2801
    Is there a possibility to turn off the automatic enclosing of all written content within <p></p> in CKEditor 3.x? I tried CKEDITOR.config.enterMode = CKEDITOR.ENTER_BR; but this just changes the inline linebreaks to <br /> while leaving the enclosing paragraph. Currently writing "Test" produces this output <p> Test</p> but I want it to be simply Test Is there a configuration property for this or would another inline editor to be better suited for this?

    Read the article

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Converting a Word document to LaTeX format

    - by Mehper C. Palavuzlar
    I'm preparing a book to be published and keeping everything in .docx files. Other than text the files include graphs (jpeg) and lots of equations typed in MathType. Since MS Word is not fully appropriate to balance text and shapes according to book format, some pages are having spacings at the bottom after some text, and then comes a shape on the next page. I know that LaTeX is very good at formatting, so is it possible to convert MS Word documents (or PDF documents, since I can easily convert them to PDF) into LaTeX format so that I can handle my work in LaTeX from now on?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • O'Reilly Safari Books Online and Sony Reader

    - by Steve
    I've accumulated a good collection of book snippets in pdf format from Safari Online and I was thinking about getting an ebook reader, specifically the Sony-PRS300, to hold them all for portable reference. If anyone has done this, two questions. Are there any DRM restrictions when the pdfs are put on the reader? I can't see any restrictions flat out in the pdfs on my notebook. There's a watermark that says the pdf is licensed to me. How good is the reader at rendering complex pdfs, with code snippets and illustrations? I read a previous post where it works fine in landscape mode. I can deal with that. Thanks in advance.

    Read the article

  • Create Word files from Excel content

    - by Lennart
    I have an Excel file that I want to split into several files (Word, PDF is also good), based on content. The content is somewhat like this: Person Fase Date Item Text A 1 01-01-2012 Z Lorem ipsum A 2 01-02-2012 X Lorem ipsum B 1 02-01-2012 Y Lorem ipsum C 2 01-01-2012 Z Lorem ipsum I want Word/PDF documents with names like Person_Fase.docx And as content the date, item and text. Idealy in a table layout. Any hints/ clues on how to get there? It's about 700 clients, with up to 300 Excel entries each.

    Read the article

  • Open Microsoft Publisher Document on Linux

    - by Peter
    I'm pretty sure the options consist of Just don't do it (use a nice open standard file format). Not great when someone sends you something. Translate the format on Windows. I think you need Publisher, the viewer won't even print. But you can download a trial version for a once off (been there, done that). Submit the file for online translation to PDF. www.pdfonline.com/convert-pdf/ Use a Windows VM, wine, crossover office, Win4Lin, or otherwise run Publisher "under" linux. What I really want to do is convert it to something nicer natively under Linux.

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • Is there any way to search within OneNote 2007 attachments

    - by jtolle
    I'm starting to use OneNote (2007) more. One thing I'd like to do is take notes on papers I have read. That is, I attach, say, a PDF file, and then type in some notes about it. Sometimes I do other stuff like copy some key text or figures from the paper, so OneNote is great for this because all that plus my own notes plus the file itself can all be in one place. However, the OneNote search doesn't seem to be able to search within said PDF files. Windows search finds things, but just in the OneNote cache, not the actual Onenote .one files. (Presumably that will only work for recently accessed stuff, and in any case doesn't take me to my actual notes.) Is there a way to do what I want? If not, does anyone have a suggestion (or link) as to how to best use OneNote to store (and later search for!) this kind of content and notes?

    Read the article

  • adding remote ssh printer as local printer

    - by guest
    I have SSH access to a remote host (FreeBSD) that has a printer set up. I do not have root access on that host or any other special user rights. Now I want to print directly from my laptop on that printer (Ubuntu 10.10). The problem is that I don't know how to "import" or whatever the the printer, as it needs authetification from my user account (print quota limitations). E-mailing me the files I want to print or scp them every time is a pain, ATM I pipe the PostScript output manually to a ssh command, but that's also a huge working overhead. E.g. when I want to print a foo.pdf pdftops '/path/to/foo.pdf' - | ssh user@remotehost 'lpr -P printername' So, does anyone know of a smooth way to shorten this procedure? Ideally I would just want to use a printername instead of the whole ssh command

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • Unable to browse some pdfs and docs.

    - by JamesEggers
    I have a web site that uses Microsoft Indexing Service to index and query a directory that holds various documents of type pdf, rtf, mht, and doc. The indexing and querying works well (for the most part); however, some files will load while others will not. This is a Windows Server 2003 box running the site using IIS 6. The indexed directory is a sub directory off of the site's root directory (i.e. http://my.domain.com/files/). The file paths are accurate in the URL; however, I can only access some of the files of each file type. The files that I cannot access give a 404 File Not Found. I am able to open all files via windows explorer;however, attempting to open them via a browser over http is hit and miss. Has anyone experienced this issue and know how to resolve it? Anyone have any idea why I could access some files but not others? Does anyone have any recommendations on what to look into to try this (i.e. does owner matter or something like that?)? EDIT: Here is the Request and Response Headers for a bad file: GET /files/file1.pdf HTTP/1.1 Accept: image/gif, image/jpeg, image/pjpeg, image/pjpeg, application/x-shockwave-flash, application/xaml+xml, application/vnd.ms-xpsdocument, application/x-ms-xbap, application/x-ms-application, application/x-silverlight, application/vnd.ms-excel, application/vnd.ms-powerpoint, application/msword, / Accept-Language: en-us User-Agent: Mozilla/4.0 (compatible; MSIE 8.0; Windows NT 5.1; Trident/4.0; .NET CLR 1.1.4322; .NET CLR 2.0.50727; .NET CLR 3.0.04506.30; .NET CLR 3.0.04506.590; .NET CLR 3.0.04506.648; .NET CLR 3.5.21022; .NET CLR 3.0.4506.2152; .NET CLR 3.5.30729) Accept-Encoding: gzip, deflate Proxy-Connection: Keep-Alive Host: my.domain.com HTTP/1.1 404 Not Found Content-Length: 1635 Content-Type: text/html Server: Microsoft-IIS/6.0 X-Powered-By: ASP.NET Date: Mon, 01 Jun 2009 15:38:54 GMT [typical 404 page markup excluded] Here is the Request/Response headers for the good file: GET /files/file2.pdf HTTP/1.1 Accept: image/gif, image/jpeg, image/pjpeg, image/pjpeg, application/x-shockwave-flash, application/xaml+xml, application/vnd.ms-xpsdocument, application/x-ms-xbap, application/x-ms-application, application/x-silverlight, application/vnd.ms-excel, application/vnd.ms-powerpoint, application/msword, / Accept-Language: en-us User-Agent: Mozilla/4.0 (compatible; MSIE 8.0; Windows NT 5.1; Trident/4.0; .NET CLR 1.1.4322; .NET CLR 2.0.50727; .NET CLR 3.0.04506.30; .NET CLR 3.0.04506.590; .NET CLR 3.0.04506.648; .NET CLR 3.5.21022; .NET CLR 3.0.4506.2152; .NET CLR 3.5.30729) Accept-Encoding: gzip, deflate Proxy-Connection: Keep-Alive Host: my.domain.com HTTP/1.1 200 OK Content-Length: 352464 Content-Type: application/pdf Last-Modified: Tue, 13 Jan 2009 15:27:35 GMT Accept-Ranges: bytes ETag: "74ccc5759375c91:2a47" Server: Microsoft-IIS/6.0 X-Powered-By: ASP.NET Date: Mon, 01 Jun 2009 15:50:33 GMT

    Read the article

  • How to preserve sibling element position when one sibling is absolutely positioned?

    - by Casey
    In the snippet below, the child div is normally positioned until it is :hovered , when it becomes absolutely positioned. The reasoning behind this markup is to simulate a popup style in a limited environment where I can't use a <select> (among other limitations). When child is hovered, the sibling elements jump around, which is expected, as the contents of the block have changed. But how can I preserve their positioning? That is, what CSS can I add to prevent the siblings from jumping around when child is hovered. Javascript is also not allowed, so please no answers using JS. HTML: <div class="container"> <div class="child"> <span class="d4"></span> <label><input type="radio" name="radio" value="1"/>One</label> <label><input type="radio" name="radio" value="2"/>Two</label> </div> <input type="text" name="sibling"/> <button name="sibling2">Button</button> </div> CSS: .container, .child, button { display:inline-block; } .child { vertical-align: middle; width: 35px; height: 35px; } .child:hover { background: gray; position:absolute; width: 100px; height: auto; } .child:hover > .d4 { display: none; } .child label { display:none; } .child:hover label { display: inline-block; } .d4 { background-position: -411px -1px; width: 35px; height: 35px; background-image: url("https://i.imgur.com/zkgyBOi.png"); background-repeat: no-repeat; color: transparent; display: inline-block; } Here's a fiddle: http://jsfiddle.net/cpctZ/1/

    Read the article

< Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >