Search Results

Search found 3856 results on 155 pages for 'io'.

Page 100/155 | < Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >

  • Can obfuscation (proguard) lead to MIDlet malfunction?

    - by eMgz
    Hi, Im trying to obfuscate a Java MIDlet with proguard. It runs ok on the PC, however, when I run it on the phone, the program opens, connects to the server, and then freezes. If I disable obfuscation, it runs ok again on the phone. Ive tryed all the obfuscation levels for apps (7, 8 and 9 at NetBeans), and none of them seems to work properly, and I cant release this app for comercial use without obfuscation. Also, the compiler throws some warnings: Note: duplicate definition of library class [java.io.ByteArrayOutputStream] Note: there were 14 duplicate class definitions. But I dont know if this is realy the problem. Does anyone knows what is wrong? The obfuscator arguments are listed below: Obfuscator Arguments (7): -dontusemixedcaseclassnames -default package '' -keep public class ** { public *; } Obfuscator Arguments (8): same as (7) plus -overloadaggressively. Obfuscator Arguments (9): same as (8) but -keep public class ** extends javax.microedition.midlet.MIDlet { public *; } instead. Thanks.

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • Spring Roo unable to generate Selenium tests because of Xerces error

    - by Wraith
    After watching Roo Google IO, I decided to try it out using this tutorial, but I'm getting stuck when trying to create Selenium tests. ~.web roo> selenium test --controller ~.web.PizzaOrderController Created SRC_MAIN_WEBAPP/selenium Created SRC_MAIN_WEBAPP/selenium/test-pizzaorder.xhtml Created SRC_MAIN_WEBAPP/selenium/test-suite.xhtml Undo create SRC_MAIN_WEBAPP/selenium/test-suite.xhtml Undo create SRC_MAIN_WEBAPP/selenium/test-pizzaorder.xhtml Undo create SRC_MAIN_WEBAPP/selenium com.sun.org.apache.xerces.internal.dom.DeferredCommentImpl cannot be cast to org.w3c.dom.Element A person at this forum suggested removing Xerces from the classpath because Java 6 has its own XML parser based on Xerces. However, I haven't come across a clear way to remove something from the classpath, only setting it (which I think would be tedious each time). Does anyone know of a clear way to remove jars from the classpath? Has anyone encountered this Roo problem before and solved it another way?

    Read the article

  • DataContractJsonSerializer set value extension point

    - by svinto
    using System.IO; using System.Runtime.Serialization; using System.Runtime.Serialization.Json; using System.Text; namespace ConsoleApplication1 { internal class Program { private static void Main(string[] args) { var pony = new Pony(); var serializer = new DataContractJsonSerializer(pony.GetType()); var example = @"{""Foo"":null}"; var stream = new MemoryStream(Encoding.UTF8.GetBytes(example.ToCharArray())); stream.Position = 0; pony = (Pony) serializer.ReadObject(stream); // The previous line throws an exception. } } [DataContract] public class Pony { [DataMember] private int Foo { get; set; } } } Sometimes the serialization throws a casting error on Int32s being set to null. Is there any way to hook into the Json-serializer?

    Read the article

  • How to force javax xslt transformer to encode entities in utf-8?

    - by calavera.info
    I'm working on filter that should transform an output with some stylesheet. Important sections of code looks like this: PrintWriter out = response.getWriter(); ... StringReader sr = new StringReader(content); Source xmlSource = new StreamSource(sr, requestSystemId); transformer.setOutputProperty(OutputKeys.ENCODING, "UTF-8"); transformer.setParameter("encoding", "UTF-8"); //same result when using ByteArrayOutputStream xo = new java.io.ByteArrayOutputStream(); StringWriter xo = new StringWriter(); StreamResult result = new StreamResult(xo); transformer.transform(xmlSource, result); out.write(xo.toString()); The problem is that national characters are encoded as html entities and not by using UTF. Is there any way to force transformer to use UTF-8 instead of entities?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • 503 (Server Unavailable) WebException when loading local XHTML file

    - by kcoppock
    Hello! So I'm currently working on an ePub reader application, and I've been reading through a bunch of regular XML files just fine with System.Xml and XmlDocument: XmlDocument xmldoc = new XmlDocument(); xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "META-INF/container.xml")); XmlNodeList xnl = xmldoc.GetElementsByTagName("rootfile"); However, now I'm trying to open the XHTML files that contain the actual book text, and they're XHTML files. Now I don't really know the difference between the two, but I'm getting the following error with this code (in the same document, using the same XmlDocument and XmlNodeList variable) xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "OEBPS/part1.xhtml")); "WebException was unhandled: The remote server returned an error: (503) Server Unavailable" It's a local document, so I'm not understanding why it's giving this error? Any help would be greatly appreciated. :) I've got the full source code here if it helps: http://drop.io/epubtest (I know the ePubConstructor.ParseDocument() method is horribly messy, I'm just trying to get it working at the moment before I split it into classes)

    Read the article

  • Reworking my singly linked list

    - by Stradigos
    Hello everyone, thanks for taking the time to stop by my question. Below you will find my working SLL, but I want to make more use of C# and, instead of having two classes, SLL and Node, I want to use Node's constructors to do all the work (To where if you pass a string through the node, the constructor will chop it up into char nodes). The problem is, after an a few hours of tinkering, I'm not really getting anywhere... using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { SLL mySLL = new SLL(); mySLL.add('a'); mySLL.add('b'); mySLL.add('c'); mySLL.add('d'); mySLL.add('e'); mySLL.add('f'); Console.Out.WriteLine("Node count = " + mySLL.count); mySLL.reverse(); mySLL.traverse(); Console.Out.WriteLine("\n The header is: " + mySLL.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; public Node() { next = null; } public Node(char c) { this.data = c; } public Node(string s) { } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } } class SLL { private Node head; private int totalNode; public SLL() { head = null; totalNode = 0; } public void add(char s) { if (head == null) { head = new Node(); head.data = s; } else { Node temp; temp = new Node(); temp.data = s; temp.nextNode = head; head = temp; } totalNode++; } public int count { get { return totalNode; } } public char gethead { get { return head.data; } } public void traverse() { Node temp = head; while(temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public void reverse() { Node q = null; Node p = this.head; while(p!=null) { Node r=p; p=p.nextNode; r.nextNode=q; q=r; } this.head = q; } } } } Here's what I have so far in trying to work it into Node's constructors: using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { //Node myList = new Node(); //TextReader tr = new StreamReader("data.txt"); //string line; //while ((line = tr.ReadLine()) != null) //{ // Console.WriteLine(line); //} //tr.Close(); Node myNode = new Node("hello"); Console.Out.WriteLine(myNode.count); myNode.reverse(); myNode.traverse(); // Console.Out.WriteLine(myNode.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; private Node head; private int totalNode; public Node() { head = null; totalNode = 0; } public Node(char c) { if (head == null) { head = new Node(); head.data = c; } else { Node temp; temp = new Node(); temp.data = c; temp.nextNode = head; head = temp; } totalNode++; } public Node(string s) { foreach (char x in s) { new Node(x); } } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } public void reverse() { Node q = null; Node p = this.head; while (p != null) { Node r = p; p = p.nextNode; r.nextNode = q; q = r; } this.head = q; } public void traverse() { Node temp = head; while (temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public int count { get { return totalNode; } } } } } Ideally, the only constructors and methods I would be left with are Node(), Node(char c), Node(string s), Node reserve() and I'll be reworking traverse into a ToString overload. Any suggestions?

    Read the article

  • Android RandomAccessFile usage from resource

    - by lacas
    my code is String fileIn = resources.getResourceName(resourceID); Log.e("fileIn", fileIn); //BufferedReader buffer = new BufferedReader(new InputStreamReader(fileIn)); RandomAccessFile buffer = null; try { buffer = new RandomAccessFile(fileIn, "r"); } catch (FileNotFoundException e) { Log.e("err", ""+e); } /fileIn(6062): ls3d.gold.paper:raw/wwe_obj i get 11-26 15:06:35.027: ERROR/err(6062): java.io.FileNotFoundException: /ls3d.gold.paper:raw/wwe_obj (No such file or directory) How can I access a file using randomaccessfile in java? How can I load from a resource? (R.raw.wwe_obj)

    Read the article

  • Compact Framework : Read a SQL CE database on a PDA from a PC

    - by CF_Maintainer
    Hello, I have tasked with upgrading a CF Framework 1.1 suite of apps. Currently, the PC starts a server [after confirming via RAPI that the device exists and is connected] and spawns a app on the PDA as the client. The client process on the PDA talks with the db on the PDA and returns records to the PC app [using SQL CE 2.0. OpenNETCF 1.4 for communication/io]. I have a chance to upgrade the PC and PDA suite of apps to Framework 3.5 & CF 3.5 respectively. Due to a business requirement, I cannot get rid of workflow requiring the PC app to show a preview of the work done on the PDA. Question : Are there better ways to achieve the above in general with the constraints I have? I would really appreciate any Ideas/advice.

    Read the article

  • Seam cache provider with ehcache null

    - by Cateno Viglio
    Hi every one, I'm trying to configure seam/ehcache following the tutorial from jboss page: http://docs.jboss.org/seam/2.1.2/reference/en-US/html/cache.html I put the ehcache.1.2.3.jar in project.ear/lib and injected CacheProvider as especified, but the CacheProvider always return null. The documentation doesn't show any aditional configuration for ehcache, just for jboss cache. I am probably doing something wrong, it's impossible be so easy :). besides put the jar in /lib, i created the following seam component to test: @Scope(ScopeType.SESSION) @Name("cacheBean") public class CacheSeamBean implements java.io.Serializable { @In(required=false, create=true) private EntityManager em; @Logger private Log log; @In private Events events; @In CacheProvider cacheProvider; Boolean blLoaded = Boolean.FALSE; @Create public void buscar() { if (!blLoaded){ List<Parametro> lstParametro = em.createQuery("select p from Parametro p").getResultList(); for (Parametro parametro : lstParametro){ cacheProvider.put(parametro.getCodigo(), parametro.getValor()); } blLoaded= Boolean.TRUE; } } } Thanks

    Read the article

  • Problem using System.Xml in unit test in MonoDevelop (MonoTouch)

    - by hambonious
    I'm new to the MonoDevelop and MonoTouch environment so hopefully I'm just missing something easy here. When I have a unit test that requires the System.Xml or System.Xml.Linq namespaces, I get the following error when I run the test: System.IO.FileNotFoundException : Could not load file or assembly 'System.Xml.Linq, Version=2.0.5.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. Things I've verified: I have the proper usings in the test. The project builds with no problems. Using these namespaces work fine when I run the app in the emulator. I've written a very simple unit test to prove that unit testing works at all (and it does). I'm a test driven kinda guy so I can't wait to get this working so I can progress with my app. Thanks in advance.

    Read the article

  • Need help with displaying the message correctly in the pole display

    - by SA
    Hi, I am using an HP RS232 pole display with the following setting: Char type: USA/Europe (default) Command mode: EPSON (default) Baud rate: 9600, n , 8, 1 (default?) Passthru None (Default) Here's the code using System.IO.Ports; private SerialPort port; port = new SerialPort("COM2", 9600, Parity.None, 8, StopBits.One); port.Handshake = Handshake.None; Port.WriteLine("Welocome to something something"); It has 2 lines consisting of 20 characters each with a total of 40 characters. I have no control how and where the characters get displayed. I have set it to accept ASCII char set and so I am able to type as is visble in the Writeline message

    Read the article

  • Can't get my head around background workers in .NET

    - by Connel
    I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

    Read the article

  • Redis version on Cloudbees is out of date?

    - by Alan Krueger
    I'm setting up an OSS build in Cloudbees with /usr/sbin/redis-server being started as one of the build tasks: + /usr/sbin/redis-server [204] 04 Nov 03:52:58 # Warning: no config file specified, using the default config. In order to specify a config file use 'redis-server /path/to/redis.conf' [204] 04 Nov 03:52:58 * Server started, Redis version 2.0.3 The (Redis site)[http://redis.io/download] shows 2.6.2 to be the current version and 2.4.17 as "legacy". On the extended downloads page, version 2.0.3 is deprecated. Am I launching it the wrong server executable, or are there plans to support a more recent version of Redis?

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • how to feed a file to telnet

    - by knittl
    hello community, understanding http and headers i played around with telnet to send requests. to not type everything again and again and again i thought i'd write a small textfile with all the commands i need. my file is as simple as follows: GET /somefile.php HTTP/1.1 Host: localhost i then try to feed it to telnet with io-redirection: $ telnet localhost 80 < telnet.txt but all output i get is Trying ::1... Connected to localhost. Escape character is '^]'. Connection closed by foreign host. what am i doing wrong?

    Read the article

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Java based Atom/RSS Library that works in Google App Engine

    - by Littlejon
    I am trying to publish an Atom/RSS feed in my Java based Google App Engine code. I have tried using Rome and keep getting the following error (tried googling without success), also the code I am running that generates the error is the demo code (so I get the feeling Rome won't work with GAE) java.lang.NoClassDefFoundError: org/jdom/JDOMException at com.sun.syndication.io.SyndFeedOutput.<init>(SyndFeedOutput.java:44) What I am looking for is recommendations for a simple Java library to create and publish an Atom feed from within Google App Engine. Thanks.

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

< Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >