Search Results

Search found 9552 results on 383 pages for 'row henson'.

Page 100/383 | < Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >

  • SQL SERVER – SmallDateTime and Precision – A Continuous Confusion

    - by pinaldave
    Some kinds of confusion never go away. Here is one of the ancient confusing things in SQL. The precision of the SmallDateTime is one concept that confuses a lot of people, proven by the many messages I receive everyday relating to this subject. Let me start with the question: What is the precision of the SMALLDATETIME datatypes? What is your answer? Write it down on your notepad. Now if you do not want to continue reading the blog post, head to my previous blog post over here: SQL SERVER – Precision of SMALLDATETIME. A Social Media Question Since the increase of social media conversations, I noticed that the amount of the comments I receive on this blog is a bit staggering. I receive lots of questions on facebook, twitter or Google+. One of the very interesting questions yesterday was asked on Facebook by Raghavendra. I am re-organizing his script and asking all of the questions he has asked me. Let us see if we could help him with his question: CREATE TABLE #temp (name VARCHAR(100),registered smalldatetime) GO DECLARE @test smalldatetime SET @test=GETDATE() INSERT INTO #temp VALUES ('Value1',@test) INSERT INTO #temp VALUES ('Value2',@test) GO SELECT * FROM #temp ORDER BY registered DESC GO DROP TABLE #temp GO Now when the above script is ran, we will get the following result: Well, the expectation of the query was to have the following result. The row which was inserted last was expected to return as first row in result set as the ORDER BY descending. Side note: Because the requirement is to get the latest data, we can’t use any  column other than smalldatetime column in order by. If we use name column in the order by, we will get an incorrect result as it can be any name. My Initial Reaction My initial reaction was as follows: 1) DataType DateTime2: If file precision of the column is expected from the column which store date and time, it should not be smalldatetime. The precision of the column smalldatetime is One Minute (Read Here) for finer precision use DateTime or DateTime2 data type. Here is the code which includes above suggestion: CREATE TABLE #temp (name VARCHAR(100), registered datetime2) GO DECLARE @test datetime2 SET @test=GETDATE() INSERT INTO #temp VALUES ('Value1',@test) INSERT INTO #temp VALUES ('Value2',@test) GO SELECT * FROM #temp ORDER BY registered DESC GO DROP TABLE #temp GO 2) Tie Breaker Identity: There are always possibilities that two rows were inserted at the same time. In that case, you may need a tie breaker. If you have an increasing identity column, you can use that as a tie breaker as well. CREATE TABLE #temp (ID INT IDENTITY(1,1), name VARCHAR(100),registered datetime2) GO DECLARE @test datetime2 SET @test=GETDATE() INSERT INTO #temp VALUES ('Value1',@test) INSERT INTO #temp VALUES ('Value2',@test) GO SELECT * FROM #temp ORDER BY ID DESC GO DROP TABLE #temp GO Those two were the quick suggestions I provided. It is not necessary that you should use both advices. It is possible that one can use only DATETIME datatype or Identity column can have datatype of BIGINT or have another tie breaker. An Alternate NO Solution In the facebook thread this was also discussed as one of the solutions: CREATE TABLE #temp (name VARCHAR(100),registered smalldatetime) GO DECLARE @test smalldatetime SET @test=GETDATE() INSERT INTO #temp VALUES ('Value1',@test) INSERT INTO #temp VALUES ('Value2',@test) GO SELECT name, registered, ROW_NUMBER() OVER(ORDER BY registered DESC) AS "Row Number" FROM #temp ORDER BY 3 DESC GO DROP TABLE #temp GO However, I believe it is not the solution and can be further misleading if used in a production server. Here is the example of why it is not a good solution: CREATE TABLE #temp (name VARCHAR(100) NOT NULL,registered smalldatetime) GO DECLARE @test smalldatetime SET @test=GETDATE() INSERT INTO #temp VALUES ('Value1',@test) INSERT INTO #temp VALUES ('Value2',@test) GO -- Before Index SELECT name, registered, ROW_NUMBER() OVER(ORDER BY registered DESC) AS "Row Number" FROM #temp ORDER BY 3 DESC GO -- Create Index ALTER TABLE #temp ADD CONSTRAINT [PK_#temp] PRIMARY KEY CLUSTERED (name DESC) GO -- After Index SELECT name, registered, ROW_NUMBER() OVER(ORDER BY registered DESC) AS "Row Number" FROM #temp ORDER BY 3 DESC GO DROP TABLE #temp GO Now let us examine the resultset. You will notice that an index which is created on the base table which is (indeed) schema change the table but can affect the resultset. As you can see, an index can change the resultset, so this method is not yet perfect to get the latest inserted resultset. No Schema Change Requirement After giving these two suggestions, I was waiting for the feedback of the asker. However, the requirement of the asker was there can’t be any schema change because the application was used by many other applications. I validated again, and of course, the requirement is no schema change at all. No addition of the column of change of datatypes of any other columns. There is no further help as well. This is indeed an interesting question. I personally can’t think of any solution which I could provide him given the requirement of no schema change. Can you think of any other solution to this? Need of Database Designer This question once again brings up another ancient question:  “Do we need a database designer?” I often come across databases which are facing major performance problems or have redundant data. Normalization is often ignored when a database is built fast under a very tight deadline. Often I come across a database which has table with unnecessary columns and performance problems. While working as Developer Lead in my earlier jobs, I have seen developers adding columns to tables without anybody’s consent and retrieving them as SELECT *.  There is a lot to discuss on this subject in detail, but for now, let’s discuss the question first. Do you have any suggestions for the above question? Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: CodeProject, Developer Training, PostADay, SQL, SQL Authority, SQL DateTime, SQL Query, SQL Server, SQL Tips and Tricks, SQLServer, T SQL, Technology

    Read the article

  • Cardinality Estimation Bug with Lookups in SQL Server 2008 onward

    - by Paul White
    Cost-based optimization stands or falls on the quality of cardinality estimates (expected row counts).  If the optimizer has incorrect information to start with, it is quite unlikely to produce good quality execution plans except by chance.  There are many ways we can provide good starting information to the optimizer, and even more ways for cardinality estimation to go wrong.  Good database people know this, and work hard to write optimizer-friendly queries with a schema and metadata (e.g. statistics) that reduce the chances of poor cardinality estimation producing a sub-optimal plan.  Today, I am going to look at a case where poor cardinality estimation is Microsoft’s fault, and not yours. SQL Server 2005 SELECT th.ProductID, th.TransactionID, th.TransactionDate FROM Production.TransactionHistory AS th WHERE th.ProductID = 1 AND th.TransactionDate BETWEEN '20030901' AND '20031231'; The query plan on SQL Server 2005 is as follows (if you are using a more recent version of AdventureWorks, you will need to change the year on the date range from 2003 to 2007): There is an Index Seek on ProductID = 1, followed by a Key Lookup to find the Transaction Date for each row, and finally a Filter to restrict the results to only those rows where Transaction Date falls in the range specified.  The cardinality estimate of 45 rows at the Index Seek is exactly correct.  The table is not very large, there are up-to-date statistics associated with the index, so this is as expected. The estimate for the Key Lookup is also exactly right.  Each lookup into the Clustered Index to find the Transaction Date is guaranteed to return exactly one row.  The plan shows that the Key Lookup is expected to be executed 45 times.  The estimate for the Inner Join output is also correct – 45 rows from the seek joining to one row each time, gives 45 rows as output. The Filter estimate is also very good: the optimizer estimates 16.9951 rows will match the specified range of transaction dates.  Eleven rows are produced by this query, but that small difference is quite normal and certainly nothing to worry about here.  All good so far. SQL Server 2008 onward The same query executed against an identical copy of AdventureWorks on SQL Server 2008 produces a different execution plan: The optimizer has pushed the Filter conditions seen in the 2005 plan down to the Key Lookup.  This is a good optimization – it makes sense to filter rows out as early as possible.  Unfortunately, it has made a bit of a mess of the cardinality estimates. The post-Filter estimate of 16.9951 rows seen in the 2005 plan has moved with the predicate on Transaction Date.  Instead of estimating one row, the plan now suggests that 16.9951 rows will be produced by each clustered index lookup – clearly not right!  This misinformation also confuses SQL Sentry Plan Explorer: Plan Explorer shows 765 rows expected from the Key Lookup (it multiplies a rounded estimate of 17 rows by 45 expected executions to give 765 rows total). Workarounds One workaround is to provide a covering non-clustered index (avoiding the lookup avoids the problem of course): CREATE INDEX nc1 ON Production.TransactionHistory (ProductID) INCLUDE (TransactionDate); With the Transaction Date filter applied as a residual predicate in the same operator as the seek, the estimate is again as expected: We could also force the use of the ultimate covering index (the clustered one): SELECT th.ProductID, th.TransactionID, th.TransactionDate FROM Production.TransactionHistory AS th WITH (INDEX(1)) WHERE th.ProductID = 1 AND th.TransactionDate BETWEEN '20030901' AND '20031231'; Summary Providing a covering non-clustered index for all possible queries is not always practical, and scanning the clustered index will rarely be optimal.  Nevertheless, these are the best workarounds we have today. In the meantime, watch out for poor cardinality estimates when a predicate is applied as part of a lookup. The worst thing is that the estimate after the lookup join in the 2008+ plans is wrong.  It’s not hopelessly wrong in this particular case (45 versus 16.9951 is not the end of the world) but it easily can be much worse, and there’s not much you can do about it.  Any decisions made by the optimizer after such a lookup could be based on very wrong information – which can only be bad news. If you think this situation should be improved, please vote for this Connect item. © 2012 Paul White – All Rights Reserved twitter: @SQL_Kiwi email: [email protected]

    Read the article

  • WPF Databinding- Part 2 of 3

    - by Shervin Shakibi
    This is a follow up to my previous post WPF Databinding- Not your fathers databinding Part 1-3 you can download the source code here  http://ssccinc.com/wpfdatabinding.zip Example 04   In this example we demonstrate  the use of default properties and also binding to an instant of an object which is part of a collection bound to its container. this is actually not as complicated as it sounds. First of all, lets take a look at our Employee class notice we have overridden the ToString method, which will return employees First name , last name and employee number in parentheses, public override string ToString()        {            return String.Format("{0} {1} ({2})", FirstName, LastName, EmployeeNumber);        }   in our XAML we have set the itemsource of the list box to just  “Binding” and the Grid that contains it, has its DataContext set to a collection of our Employee objects. DataContext="{StaticResource myEmployeeList}"> ….. <ListBox Name="employeeListBox"  ItemsSource="{Binding }" Grid.Row="0" /> the ToString in the method for each instance will get executed and the following is a result of it. if we did not have a ToString the list box would look  like this: now lets take a look at the grid that will display the details when someone clicks on an Item, the Grid has the following DataContext DataContext="{Binding ElementName=employeeListBox,            Path=SelectedItem}"> Which means its bound to a specific instance of the Employee object. and within the gird we have textboxes that are bound to different Properties of our class. <TextBox Grid.Row="0" Grid.Column="1" Text="{Binding Path=FirstName}" /> <TextBox Grid.Row="1" Grid.Column="1" Text="{Binding Path=LastName}" /> <TextBox Grid.Row="2" Grid.Column="1" Text="{Binding Path=Title}" /> <TextBox Grid.Row="3" Grid.Column="1" Text="{Binding Path=Department}" />   Example 05   This project demonstrates use of the ObservableCollection and INotifyPropertyChanged interface. Lets take a look at Employee.cs first, notice it implements the INotifyPropertyChanged interface now scroll down and notice for each setter there is a call to the OnPropertyChanged method, which basically will will fire up the event notifying to the value of that specific property has been changed. Next EmployeeList.cs notice it is an ObservableCollection . Go ahead and set the start up project to example 05 and then run. Click on Add a new employee and the new employee should appear in the list box.   Example 06   This is a great example of IValueConverter its actuall a two for one deal, like most of my presentation demos I found this by “Binging” ( formerly known as g---ing) unfortunately now I can’t find the original author to give him  the credit he/she deserves. Before we look at the code lets run the app and look at the finished product, put in 0 in Celsius  and you should see Fahrenheit textbox displaying to 32 degrees, I know this is calculating correctly from my elementary school science class , also note the color changed to blue, now put in 100 in Celsius which should give us 212 Fahrenheit but now the color is red indicating it is hot, and finally put in 75 Fahrenheit and you should see 23.88 for Celsius and the color now should be black. Basically IValueConverter allows us different types to be bound, I’m sure you have had problems in the past trying to bind to Date values . First look at FahrenheitToCelciusConverter.cs first notice it implements IValueConverter. IValueConverter has two methods Convert and ConvertBack. In each method we have the code for converting Fahrenheit to Celsius and vice Versa. In our XAML, after we set a reference in our Windows.Resources section. and for txtCelsius we set the path to TxtFahrenheit and the converter to an instance our FahrenheitToCelciusConverter converter. no need to repeat this for TxtFahrenheit since we have a convert and ConvertBack. Text="{Binding  UpdateSourceTrigger=PropertyChanged,            Path=Text,ElementName=txtFahrenheit,            Converter={StaticResource myTemperatureConverter}}" As mentioned earlier this is a twofer Demo, in the second demo, we basically are converting a double datatype to a brush. Lets take a look at TemperatureToColorConverter, notice we in our Covert Method, if the value is less than our cold temperature threshold we return a blue brush and if it is higher than our hot temperature threshold we return a redbrush. since we don’t have to convert a brush to double value in our example the convert back is not being implemented. Take time and go through these three examples and I hope you have a better understanding   of databinding, ObservableCollection  and IValueConverter . Next blog posting we will talk about ValidationRule, DataTemplates and DataTemplate triggers.

    Read the article

  • How can I implement a database TableView like thing in C++?

    - by Industrial-antidepressant
    How can I implement a TableView like thing in C++? I want to emulating a tiny relation database like thing in C++. I have data tables, and I want to transform it somehow, so I need a TableView like class. I want filtering, sorting, freely add and remove items and transforming (ex. view as UPPERCASE and so on). The whole thing is inside a GUI application, so datatables and views are attached to a GUI (or HTML or something). So how can I identify an item in the view? How can I signal it when the table is changed? Is there some design pattern for this? Here is a simple table, and a simple data item: #include <string> #include <boost/multi_index_container.hpp> #include <boost/multi_index/member.hpp> #include <boost/multi_index/ordered_index.hpp> #include <boost/multi_index/random_access_index.hpp> using boost::multi_index_container; using namespace boost::multi_index; struct Data { Data() {} int id; std::string name; }; struct row{}; struct id{}; struct name{}; typedef boost::multi_index_container< Data, indexed_by< random_access<tag<row> >, ordered_unique<tag<id>, member<Data, int, &Data::id> >, ordered_unique<tag<name>, member<Data, std::string, &Data::name> > > > TDataTable; class DataTable { public: typedef Data item_type; typedef TDataTable::value_type value_type; typedef TDataTable::const_reference const_reference; typedef TDataTable::index<row>::type TRowIndex; typedef TDataTable::index<id>::type TIdIndex; typedef TDataTable::index<name>::type TNameIndex; typedef TRowIndex::iterator iterator; DataTable() : row_index(rule_table.get<row>()), id_index(rule_table.get<id>()), name_index(rule_table.get<name>()), row_index_writeable(rule_table.get<row>()) { } TDataTable::const_reference operator[](TDataTable::size_type n) const { return rule_table[n]; } std::pair<iterator,bool> push_back(const value_type& x) { return row_index_writeable.push_back(x); } iterator erase(iterator position) { return row_index_writeable.erase(position); } bool replace(iterator position,const value_type& x) { return row_index_writeable.replace(position, x); } template<typename InputIterator> void rearrange(InputIterator first) { return row_index_writeable.rearrange(first); } void print_table() const; unsigned size() const { return row_index.size(); } TDataTable rule_table; const TRowIndex& row_index; const TIdIndex& id_index; const TNameIndex& name_index; private: TRowIndex& row_index_writeable; }; class DataTableView { DataTableView(const DataTable& source_table) {} // How can I implement this? // I want filtering, sorting, signaling upper GUI layer, and sorting, and ... }; int main() { Data data1; data1.id = 1; data1.name = "name1"; Data data2; data2.id = 2; data2.name = "name2"; DataTable table; table.push_back(data1); DataTable::iterator it1 = table.row_index.iterator_to(table[0]); table.erase(it1); table.push_back(data1); Data new_data(table[0]); new_data.name = "new_name"; table.replace(table.row_index.iterator_to(table[0]), new_data); for (unsigned i = 0; i < table.size(); ++i) std::cout << table[i].name << std::endl; #if 0 // using scenarios: DataTableView table_view(table); table_view.fill_from_source(); // synchronization with source table_view.remove(data_item1); // remove item from view table_view.add(data_item2); // add item from source table table_view.filter(filterfunc); // filtering table_view.sort(sortfunc); // sorting // modifying from source_able, hot to signal the table_view? // FYI: Table view is atteched to a GUI item table.erase(data); table.replace(data); #endif return 0; }

    Read the article

  • Moving items from one tableView to another tableView with extra's

    - by Totumus Maximus
    Let's say I have 2 UITableViews next to eachother on an ipad in landscape-mode. Now I want to move multiple items from one tableView to the other. They are allowed to be inserted on the bottom of the other tableView. Both have multiSelection activated. Now the movement itself is no problem with normal cells. But in my program each cell has an object which contains the consolidationState of the cell. There are 4 states a cell can have: Basic, Holding, Parent, Child. Basic = an ordinary cell. Holding = a cell which contains multiple childs but which wont be shown in this state. Parent = a cell which contains multiple childs and are shown directly below this cell. Child = a cell created by the Parent cell. The object in each cell also has some array which contains its children. The object also holds a quantityValue, which is displayed on the cell itself. Now the movement gets tricky. Holding and Parent cells can't move at all. Basic cells can move freely. Child cells can move freely but based on how many Child cells are left in the Parent. The parent will change or be deleted all together. If a Parent cell has more then 1 Child cell left it will stay a Parent cell. Else the Parent has no or 1 Child cell left and is useless. It will then be deleted. The items that are moved will always be of the same state. They will all be Basic cells. This is how I programmed the movement: *First I determine which of the tableViews is the sender and which is the receiver. *Second I ask all indexPathsForSelectedRows and sort them from highest row to lowest. *Then I build the data to be transferred. This I do by looping through the selectedRows and ask their object from the sender's listOfItems. *When I saved all the data I need I delete all the items from the sender TableView. This is why I sorted the selectedRows so I can start at the highest indexPath.row and delete without screwing up the other indexPaths. *When I loop through the selectedRows I check whether I found a cell with state Basic or Child. *If its a Basic cell I do nothing and just delete the cell. (this works fine with all Basic Cells) *If its a Child cell I go and check it's Parent cell immidiately. Since all Child cells are directly below the Parent cell and no other the the Parent's Childs are below that Parent I can safely get the path of the selected Childcell and move upwards and find it's Parent cell. When this Parent cell is found (this will always happen, no exceptions) it has to change accordingly. *The Parent cell will either be deleted or the object inside will have its quantity and children reduced. *After the Parent cell has changed accordingly the Child cell is deleted similarly like the Basic cells *After the deletion of the cells the receiver tableView will build new indexPaths so the movedObjects will have a place to go. *I then insert the objects into the listOfItems of the receiver TableView. The code works in the following ways: Only Basic cells are moved. Basic cells and just 1 child for each parent is moved. A single Basic/Child cell is moved. The code doesn't work when: I select more then 1 or all childs of some parent cell. The problem happens somewhere into updating the parent cells. I'm staring blindly at the code now so maybe a fresh look will help fix things. Any help will be appreciated. Here is the method that should do the movement: -(void)moveSelectedItems { UITableView *senderTableView = //retrieves the table with the data here. UITableView *receiverTableView = //retrieves the table which gets the data here. NSArray *selectedRows = senderTableView.indexPathsForSelectedRows; //sort selected rows from lowest indexPath.row to highest selectedRows = [selectedRows sortedArrayUsingSelector:@selector(compare:)]; //build up target rows (all objects to be moved) NSMutableArray *targetRows = [[NSMutableArray alloc] init]; for (int i = 0; i<selectedRows.count; i++) { NSIndexPath *path = [selectedRows objectAtIndex:i]; [targetRows addObject:[senderTableView.listOfItems objectAtIndex:path.row]]; } //delete rows at active for (int i = selectedRows.count-1; i >= 0; i--) { NSIndexPath *path = [selectedRows objectAtIndex:i]; //check what item you are deleting. act upon the status. Parent- and HoldingCells cant be selected so only check for basic and childs MyCellObject *item = [senderTableView.listOfItems objectAtIndex:path.row]; if (item.consolidatedState == ConsolidationTypeChild) { for (int j = path.row; j >= 0; j--) { MyCellObject *consolidatedItem = [senderTableView.listOfItems objectAtIndex:j]; if (consolidatedItem.consolidatedState == ConsolidationTypeParent) { //copy the consolidated item but with 1 less quantity MyCellObject *newItem = [consolidatedItem copyWithOneLessQuantity]; //creates a copy of the object with 1 less quantity. if (newItem.quantity > 1) { newItem.consolidatedState = ConsolidationTypeParent; [senderTableView.listOfItems replaceObjectAtIndex:j withObject:newItem]; } else if (newItem.quantity == 1) { newItem.consolidatedState = ConsolidationTypeBasic; [senderTableView.listOfItems removeObjectAtIndex:j]; MyCellObject *child = [senderTableView.listOfItems objectAtIndex:j+1]; child.consolidatedState = ConsolidationTypeBasic; [senderTableView.listOfItems replaceObjectAtIndex:j+1 withObject:child]; } else { [senderTableView.listOfItems removeObject:consolidatedItem]; } [senderTableView reloadData]; } } } [senderTableView.listOfItems removeObjectAtIndex:path.row]; } [senderTableView deleteRowsAtIndexPaths:selectedRows withRowAnimation:UITableViewRowAnimationTop]; //make new indexpaths for row animation NSMutableArray *newRows = [[NSMutableArray alloc] init]; for (int i = 0; i < targetRows.count; i++) { NSIndexPath *newPath = [NSIndexPath indexPathForRow:i+receiverTableView.listOfItems.count inSection:0]; [newRows addObject:newPath]; DLog(@"%i", i); //scroll to newest items [receiverTableView setContentOffset:CGPointMake(0, fmaxf(receiverTableView.contentSize.height - recieverTableView.frame.size.height, 0.0)) animated:YES]; } //add rows at target for (int i = 0; i < targetRows.count; i++) { MyCellObject *insertedItem = [targetRows objectAtIndex:i]; //all moved items will be brought into the standard (basic) consolidationType insertedItem.consolidatedState = ConsolidationTypeBasic; [receiverTableView.ListOfItems insertObject:insertedItem atIndex:receiverTableView.ListOfItems.count]; } [receiverTableView insertRowsAtIndexPaths:newRows withRowAnimation:UITableViewRowAnimationNone]; } If anyone has some fresh ideas of why the movement is bugging out let me know. If you feel like you need some extra information I'll be happy to add it. Again the problem is in the movement of ChildCells and updating the ParentCells properly. I could use some fresh looks and outsider ideas on this. Thanks in advance. *updated based on comments

    Read the article

  • Yet another UITableView Question

    - by barbgal
    Hi, I have a strange issue in my iPhone application. I have created a UITableView with 4 Sections and 3 Rows so totally 12 Rows. But - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath The above method only gets called for 9 times instead of 12 times.why this happenning. My 4th section is not getting constructed but my 1st section gets duplicated as 4th section. Thanks for your time and help. Plese refer my code below @interface MainViewController : UITableViewController<UITextFieldDelegate,UITableViewDelegate,UITableViewDataSource> { } @end // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { CGRect frameRect = CGRectMake(0,0,320,460); UITableView *tableView = [[UITableView alloc] initWithFrame:frameRect style:UITableViewStyleGrouped]; tableView.delegate = self; tableView.dataSource = self; tableView.backgroundColor = [UIColor purpleColor]; tableView.scrollEnabled = YES; self.view = tableView; [tableView release]; [super viewDidLoad]; } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { // Return the number of rows in the section. return 3; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { // Return the number of sections. return 4; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { NSLog(@"CELL IS NIL %i", indexPath.section); static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; if (indexPath.section == 0) { if(indexPath.row == 0) { cell.text = @"Tmail"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else if ( indexPath.row == 1 ) { cell.text = @"English"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else { cell.text = @"Hindi"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } } else if (indexPath.section == 1) { if(indexPath.row == 0) { cell.text = @"Street"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else if ( indexPath.row == 1 ) { cell.text = @"City"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else { cell.text = @"State"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } } else if (indexPath.section == 2) { if(indexPath.row == 0) { cell.text = @"Salem"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else if ( indexPath.row == 1 ) { cell.text = @"Samalpatti"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else { cell.text = @"Chennai"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } } else if (indexPath.section == 3) { if(indexPath.row == 0) { cell.text = @"NOKIA"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else if ( indexPath.row == 1) { cell.text = @"SAMSUNG"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } else { cell.text = @"SONY"; UITextField *aField = [[UITextField alloc]initWithFrame:CGRectMake(100,10,200,40)]; aField.placeholder = @"Mandatory"; aField.delegate = self; aField.textColor = [UIColor blackColor]; [cell addSubview:aField]; [aField release]; } } } return cell; }

    Read the article

  • Opencart Dashboard show last months statistics

    - by John Magnolia
    How could I added the option to show the statistics for last month. PHP public function chart() { $this->load->language('common/home'); $data = array(); $data['order'] = array(); $data['customer'] = array(); $data['xaxis'] = array(); $data['order']['label'] = $this->language->get('text_order'); $data['customer']['label'] = $this->language->get('text_customer'); if (isset($this->request->get['range'])) { $range = $this->request->get['range']; } else { $range = 'month'; } switch ($range) { case 'day': for ($i = 0; $i < 24; $i++) { $query = $this->db->query("SELECT COUNT(*) AS total FROM `" . DB_PREFIX . "order` WHERE order_status_id > '0' AND (DATE(date_added) = DATE(NOW()) AND HOUR(date_added) = '" . (int)$i . "') GROUP BY HOUR(date_added) ORDER BY date_added ASC"); if ($query->num_rows) { $data['order']['data'][] = array($i, (int)$query->row['total']); } else { $data['order']['data'][] = array($i, 0); } $query = $this->db->query("SELECT COUNT(*) AS total FROM " . DB_PREFIX . "customer WHERE DATE(date_added) = DATE(NOW()) AND HOUR(date_added) = '" . (int)$i . "' GROUP BY HOUR(date_added) ORDER BY date_added ASC"); if ($query->num_rows) { $data['customer']['data'][] = array($i, (int)$query->row['total']); } else { $data['customer']['data'][] = array($i, 0); } $data['xaxis'][] = array($i, date('H', mktime($i, 0, 0, date('n'), date('j'), date('Y')))); } break; case 'week': $date_start = strtotime('-' . date('w') . ' days'); for ($i = 0; $i < 7; $i++) { $date = date('Y-m-d', $date_start + ($i * 86400)); $query = $this->db->query("SELECT COUNT(*) AS total FROM `" . DB_PREFIX . "order` WHERE order_status_id > '0' AND DATE(date_added) = '" . $this->db->escape($date) . "' GROUP BY DATE(date_added)"); if ($query->num_rows) { $data['order']['data'][] = array($i, (int)$query->row['total']); } else { $data['order']['data'][] = array($i, 0); } $query = $this->db->query("SELECT COUNT(*) AS total FROM `" . DB_PREFIX . "customer` WHERE DATE(date_added) = '" . $this->db->escape($date) . "' GROUP BY DATE(date_added)"); if ($query->num_rows) { $data['customer']['data'][] = array($i, (int)$query->row['total']); } else { $data['customer']['data'][] = array($i, 0); } $data['xaxis'][] = array($i, date('D', strtotime($date))); } break; default: case 'month': for ($i = 1; $i <= date('t'); $i++) { $date = date('Y') . '-' . date('m') . '-' . $i; $query = $this->db->query("SELECT COUNT(*) AS total FROM `" . DB_PREFIX . "order` WHERE order_status_id > '0' AND (DATE(date_added) = '" . $this->db->escape($date) . "') GROUP BY DAY(date_added)"); if ($query->num_rows) { $data['order']['data'][] = array($i, (int)$query->row['total']); } else { $data['order']['data'][] = array($i, 0); } $query = $this->db->query("SELECT COUNT(*) AS total FROM " . DB_PREFIX . "customer WHERE DATE(date_added) = '" . $this->db->escape($date) . "' GROUP BY DAY(date_added)"); if ($query->num_rows) { $data['customer']['data'][] = array($i, (int)$query->row['total']); } else { $data['customer']['data'][] = array($i, 0); } $data['xaxis'][] = array($i, date('j', strtotime($date))); } break; case 'year': for ($i = 1; $i <= 12; $i++) { $query = $this->db->query("SELECT COUNT(*) AS total FROM `" . DB_PREFIX . "order` WHERE order_status_id > '0' AND YEAR(date_added) = '" . date('Y') . "' AND MONTH(date_added) = '" . $i . "' GROUP BY MONTH(date_added)"); if ($query->num_rows) { $data['order']['data'][] = array($i, (int)$query->row['total']); } else { $data['order']['data'][] = array($i, 0); } $query = $this->db->query("SELECT COUNT(*) AS total FROM " . DB_PREFIX . "customer WHERE YEAR(date_added) = '" . date('Y') . "' AND MONTH(date_added) = '" . $i . "' GROUP BY MONTH(date_added)"); if ($query->num_rows) { $data['customer']['data'][] = array($i, (int)$query->row['total']); } else { $data['customer']['data'][] = array($i, 0); } $data['xaxis'][] = array($i, date('M', mktime(0, 0, 0, $i, 1, date('Y')))); } break; } $this->response->setOutput(json_encode($data)); } HTML <select name="range"> <option value="day">Today</option> <option value="week">This Week</option> <option value="month">This Month</option> <option value="year">This Year</option> </select>

    Read the article

  • PHP / MYSQL: Database empties when I use a variable in the WHERE condition of the last mysql_query

    - by Christian Cugnet
    <?php require 'connect.php'; $search = $_POST["search"]; These two queries work fine. So I used their format for the one below. $result = mysql_query("SELECT * FROM `subjects` WHERE $search = `student_id`"); $result2 = mysql_query("SELECT * FROM `grades` WHERE $search = `student_id`"); while($row = mysql_fetch_array($result)) { $row2 = mysql_fetch_array($result2); echo"<table border='1'>"; echo "<tr>"; echo "<th>Subjects:</th>"; echo "<th>Current Mark:</th>"; echo "<th>Edit Mark:</th>"; echo"</tr>"; echo"<tr>"; echo "<td>". $row['c1'] ."</td>"; echo "<td>". $row2['m1'] ."</td>"; echo "<td><input type='text' name='m1'></td>"; echo "</tr>"; echo "<tr>"; echo "<td>". $row['c2'] ."</td>"; echo "<td>". $row2['m2'] ."</td>"; echo "<td><input type='text' name='m2'></td>"; echo "</tr>"; echo "<tr>"; echo "<td>". $row['c3'] ."</td>"; echo "<td>". $row2['m3'] ."</td>"; echo "<td><input type='text' name='m3'></td>"; echo "</tr>"; echo "<tr>"; echo "<td>". $row['c4'] ."</td>"; echo "<td>". $row2['m4'] ."</td>"; echo "<td><input type='text' name='m4'></td>"; echo "</tr>"; echo "<tr>"; echo "<td>". $row['c5'] ."</td>"; echo "<td>". $row2['m5'] ."</td>"; echo "<td><input type='text' name='m5'></td>"; echo "</tr>"; echo "<tr>"; echo "<td>". $row['c6'] ."</td>"; echo "<td>". $row2['m6'] ."</td>"; echo "<td><input type='text' name='m6'></td>"; echo "</tr>"; echo "<tr>"; echo "<td>". $row['c7'] ."</td>"; echo "<td>". $row2['m7'] ."</td>"; echo "<td><input type='text' name='m7'></td>"; echo "</tr>"; echo "</table>"; echo "<input type='submit' name='submit' value='Submit'>"; echo "</form>"; } $M1 = $_POST["m1"]; $M2 = $_POST["m2"]; $M3 = $_POST["m3"]; $M4 = $_POST["m4"]; $M5 = $_POST["m5"]; $M6 = $_POST["m6"]; $M7 = $_POST["m7"]; It works if I put numbers e.x. 11111 Otherwise it just enters blank spaces into the table. I've tried '".$search."' I've tried ".$search." mysql_query("UPDATE grades SET m1 = '$M1', m2 = '$M2',m3 = '$M3',m4 = '$M4',m5 = '$M5',m6 = '$M6',m7 = '$M7' WHERE $search = `student_id`"); ?> Table +------------+---+---+---+---+---+---+---+ |student_id|m1|m2|m3|m4|m5|m6|m7| +------------+---+---+---+---+---+---+---+ ===Database d1 == Table structure for table grades |------ |Column|Type|Null|Default |------ |//student_id//|int(5)|No| |m1|text|No| |m2|text|No| |m3|text|No| |m4|text|No| |m5|text|No| |m6|text|No| |m7|text|No| == Dumping data for table grades |11111| | | | | | | |11112|fg|fd|f|f|fd|f|f ===Database d1 == Table structure for table subjects |------ |Column|Type|Null|Default |------ |//student_id//|int(11)|No| |c1|text|No| |c2|text|No| |c3|text|No| |c4|text|No| |c5|text|No| |c6|text|No| |c7|text|No| == Dumping data for table subjects |11111|English|Math|Science|Sport|IT|Art|History |11112|grdgg|vsbvbbb|bdbbrfd|bdbrb|dbrbfbf|fbdfbdbf|dbfbdfb

    Read the article

  • Master Details and collectionViewSource in separate views cannot make it work.

    - by devnet247
    Hi all, I really cannot seem to make/understand how it works with separate views It all works fine if a bundle all together in a single window. I have a list of Countries-Cities-etc... When you select a country it should load it's cities. Works So I bind 3 listboxes successfully using collection sources and no codebehind more or less (just code to set the datacontext and selectionChanged). you can download the project here http://cid-9db5ae91a2948485.skydrive.live.com/self.aspx/PublicFolder/2MasterDetails.zip <Window.Resources> <CollectionViewSource Source="{Binding}" x:Key="cvsCountryList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCountryList},Path=Cities}" x:Key="cvsCityList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCityList},Path=Hotels}" x:Key="cvsHotelList"/> </Window.Resources> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition/> </Grid.RowDefinitions> <TextBlock Grid.Column="0" Grid.Row="0" Text="Countries"/> <TextBlock Grid.Column="1" Grid.Row="0" Text="Cities"/> <TextBlock Grid.Column="2" Grid.Row="0" Text="Hotels"/> <ListBox Grid.Column="0" Grid.Row="1" Name="lstCountries" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding Source={StaticResource cvsCountryList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="1" Grid.Row="1" Name="lstCities" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding Source={StaticResource cvsCityList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="2" Grid.Row="1" Name="lstHotels" ItemsSource="{Binding Source={StaticResource cvsHotelList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> </Grid> Does not work I am trying to implement the same using a view for each eg(LeftSideMasterControl -RightSideDetailsControls) However I cannot seem to make them bind. Can you help? I would be very grateful so that I can understand how you communicate between userControls You can download the project here. http://cid-9db5ae91a2948485.skydrive.live.com/self.aspx/PublicFolder/2MasterDetails.zip I have as follows LeftSideMasterControl.xaml <Grid> <ListBox Name="lstCountries" SelectionChanged="OnSelectionChanged" DisplayMemberPath="Name" ItemsSource="{Binding Countries}"/> </Grid> RightViewDetailsControl.xaml MainView.xaml <CollectionViewSource Source="{Binding}" x:Key="cvsCountryList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCountryList},Path=Cities}" x:Key="cvsCityList"/> </UserControl.Resources> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition Width="3*"/> </Grid.ColumnDefinitions> <Views:LeftViewMasterControl x:Name="leftSide" Margin="5" Content="{Binding Source=}"/> <GridSplitter Grid.Column="0" Grid.Row="0" Background="LightGray"/> <Views:RightViewDetailsControl Grid.Column="1" x:Name="RightSide" Margin="5"/> </Grid> ViewModels public class CountryListVM : ViewModelBase { public CountryListVM() { Countries = new ObservableCollection<CountryVM>(); } public ObservableCollection<CountryVM> Countries { get; set; } private RelayCommand _loadCountriesCommand; public ICommand LoadCountriesCommand { get { return _loadCountriesCommand ?? (_loadCountriesCommand = new RelayCommand(x => LoadCountries(), x => CanLoadCountries)); } } private static bool CanLoadCountries { get { return true; } } private void LoadCountries() { var countryList = Repository.GetCountries(); foreach (var country in countryList) { Countries.Add(new CountryVM { Name = country.Name }); } } } public class CountryVM : ViewModelBase { private string _name; public string Name { get { return _name; } set { _name = value; OnPropertyChanged("Name"); } } } public class CityListVM : ViewModelBase { private CountryVM _selectedCountry; public CityListVM(CountryVM country) { SelectedCountry = country; Cities = new ObservableCollection<CityVM>(); } public ObservableCollection<CityVM> Cities { get; set; } public CountryVM SelectedCountry { get { return _selectedCountry; } set { _selectedCountry = value; OnPropertyChanged("SelectedCountry"); } } private RelayCommand _loadCitiesCommand; public ICommand LoadCitiesCommand { get { return _loadCitiesCommand ?? (_loadCitiesCommand = new RelayCommand(x => LoadCities(), x => CanLoadCities)); } } private static bool CanLoadCities { get { return true; } } private void LoadCities() { var cities = Repository.GetCities(SelectedCountry.Name); foreach (var city in cities) { Cities.Add(new CityVM() { Name = city.Name }); } } } public class CityVM : ViewModelBase { private string _name; public string Name { get { return _name; } set { _name = value; OnPropertyChanged("Name"); } } } Models ========= public class Country { public Country() { Cities = new ObservableCollection<City>(); } public string Name { get; set; } public ObservableCollection<City> Cities { get; set; } } public class City { public City() { Hotels = new ObservableCollection<Hotel>(); } public string Name { get; set; } public ObservableCollection<Hotel> Hotels { get; set; } } public class Hotel { public string Name { get; set; } }

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Fetch image from folder via datatable does not work after placing image in subdirectory

    - by Arnold Bishkoff
    I am having trouble wrapping my head around the following I have code that fetches an image via smarty in a line img src="getsnap.php?picid={$data[$smarty.section.sec.index].picno|default:$nextpic}&typ=pic&width={$config.disp_snap_width}&height={$config.disp_snap_height}" class="smallpic" alt="" / this works if i pull the image from /temp/userimages/userid/imageNo.ext but because an OS can segfault if you store too many folders or images in a directory i have code that assigns the user image to a subdirectory based upon division of a subdir per 1000 userids. so in thise case i have user id 94 whos images get stored in /siteroot/temp/userimages/000000/94/pic_1.jpg (through 10) or tn_1 (through 10).jpg here is the code for getsnap.php <?php ob_start(); if ( !defined( 'SMARTY_DIR' ) ) { include_once( 'init.php' ); } include('core/snaps_functions.php'); if (isset($_REQUEST['username']) && $_REQUEST['username'] != '') { $userid = $osDB-getOne('select id from ! where username = ?',array(USER_TABLE, $_REQUEST['username']) ); } else { // include ( 'sessioninc.php' ); if( !isset($_GET['id']) || (isset($_GET['id'])&& (int)$_GET['id'] <= 0 ) ) { $userid = $_SESSION['UserId']; } else { $userid = $_GET['id']; } } if (!isset($_GET['picid']) ) { if ((isset($_REQUEST['type']) && $_REQUEST['type'] != 'gallery') || !isset($_REQUEST['type']) ) { $defpic = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and default_pic = ? and active = ? ',array(USER_SNAP_TABLE, $userid,'0','Y','Y' ) ); if ($defpic != '') { $picid = $defpic; } else { $picid = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and active=? order by rand()',array(USER_SNAP_TABLE, $userid,'0','Y' ) ); } unset( $defpic); } } else { $picid = $_GET['picid']; } $typ = isset( $_GET['typ'])?$_GET['typ']:'pic' ; $cond = ''; if ( ($config['snaps_require_approval'] == 'Y' || $config['snaps_require_approval'] == '1') && $userid != $_SESSION['UserId'] ) { $cond = " and active = 'Y' "; } $sql = 'select * from ! where userid = ? and picno = ? '.$cond; //Get the pic $row =& $osDB-getRow ( $sql, array( USER_SNAP_TABLE, $userid, $picid ) ); //Okay pic was found in the DB, Lets actually do something // $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; $img = getPicture($zimg, $userid, $picid, $typ, $row); //$img = getPicture($userid, $picid, $typ, $row); //$img = getPicture($dir, $userid, $picid, $typ, $row); $ext = ($typ = 'tn')?$row['tnext']:$row['picext']; // Now pic is built as // something pic_x.ext ie pic_2.jpg if ( $img != '' && ( ( hasRight('seepictureprofile') && ( $config['snaps_require_approval'] == 'Y' && $row['active'] == 'Y' ) ||$config['snaps_require_approval'] == 'N' ) || $userid == $_SESSION['UserId'] ) ) { $img2 = $img; //$img2 = $dir.'/'.$img; } else { $gender = $osDB-getOne( 'select gender from ! where id = ?', array( USER_TABLE, $userid ) ) ; if ($gender == 'M') { $nopic = SKIN_IMAGES_DIR.'male.jpg'; } elseif ($gender == 'F') { $nopic = SKIN_IMAGES_DIR.'female.jpg'; } elseif ($gender == 'D') { $nopic = SKIN_IMAGES_DIR.'director.jpg'; } $img2 = imagecreatefromjpeg($nopic); $ext = 'jpg'; } ob_end_clean(); header("Pragma: public"); header("Content-Type: image/".$ext); header("Content-Transfer-Encoding: binary"); header("Cache-Control: must-revalidate"); $ExpStr = "Expires: " . gmdate("D, d M Y H:i:s", time() - 30) . " GMT"; header($ExpStr); $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; //header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); //header("Content-Disposition: attachment; filename=$dir.'/'.profile_".$userid."".$typ.".".$ext); //header("Content-Disposition: attachment; filename=profile"$dir".'/'.".$userid."_".$typ.".".$ext); header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); /* if ($_SESSION['browser'] != 'MSIE') { header("Content-Disposition: inline" ); } */ if ($ext == 'jpg') { imagejpeg($img2); } elseif ($ext == 'gif') { imagegif($img2); } elseif ($ext == 'png') { imagepng($img2); } elseif ($ext == 'bmp') { imagewbmp($img2); } imagedestroy($img2); ?

    Read the article

  • How to bring out checboxes based on drop down list selection from DB

    - by user2199877
    I got stuck again. Can't overcome this step: loop through (in a form of checkboxes) pallets based on the lot drop down list selection, so it can be further submitted to complete the table. Please, please help. So, basically, first submit button (drop down menu) brings into the table lot number and description and also checkboxes to choose pallets. Second submit button (checboxes) brings into the table pallets numbers and weights. Thank you for any help. <?php mysql_connect('localhost','user',''); mysql_select_db('base'); $query="SELECT DISTINCT lot_number FROM pl_table"; $result=mysql_query($query); ?> <form action="" method="POST"> <select name="option_chosen"> <option>-- Select lot --</option> <?php while(list($lot_number)=mysql_fetch_row($result)) { echo "<option value=\"".$lot_number."\">".$lot_number."</option>"; } ?> </select> <input type='submit' name='submitLot' value='Submit' /> </form> <!-- need help here <h4>-- Select pallets --</h4> <form action="" method="POST"> <input type='submit' name='submitPal' value='Submit'/> </form> --> <table border="1" id="table"> <tr> <th width=80 height=30>Lot<br/>number</th> <th width=110 height=30>Description</th> <th width=90 height=30>Pallet<br/>number</th> <th width=60 height=30>Net</th> <th width=60 height=30>Gross</th> </tr> <?php if($_SERVER['REQUEST_METHOD'] =='POST') {$option_chosen=$_POST['option_chosen']; $query="SELECT * FROM pl_table WHERE lot_number='$option_chosen'"; $run=mysql_query($query); $row=mysql_fetch_array($run, MYSQLI_ASSOC); echo "<tr><td>".''."</td>"; echo "<td rowspan='5'>".$row['descr']."</td>"; echo "<td><b>".'Total weight'."<b></td>"; echo "<td>".''."</td><td>".''."</td></tr>"; echo "<td>".$row['lot_number']."</td>"; echo "<td colspan='3'>".''."</td>"; //This to be echoed when "select pallets" submited //echo "<tr><td>".$row['lot_number']."</td>"; //echo "<td>".$row['pallet_number']."</td>"; //echo "<td>".$row['net']."</td><td>".$row['gross']."</td></tr>"; } ?> </table> the table +--------------------------+-------------------------+---------+-------+ | id | lot_number | descr | pallet_number | net | gross | +--------------------------+-------------------------+---------+-------+ | 1 | 111 | black | 1 | 800 | 900 | | 2 | 111 | black | 2 | 801 | 901 | | 3 | 111 | black | 3 | 802 | 902 | | 4 | 222 | white | 1 | 800 | 900 | | 5 | 222 | white | 2 | 801 | 901 | | 6 | 222 | white | 3 | 802 | 902 | +--------------------------+-------------------------+---------+-------+

    Read the article

  • Which workaround to use for the following SQL deadlock?

    - by Marko
    I found a SQL deadlock scenario in my application during concurrency. I belive that the two statements that cause the deadlock are (note - I'm using LINQ2SQL and DataContext.ExecuteCommand(), that's where this.studioId.ToString() comes into play): exec sp_executesql N'INSERT INTO HQ.dbo.SynchronizingRows ([StudioId], [UpdatedRowId]) SELECT @p0, [t0].[Id] FROM [dbo].[UpdatedRows] AS [t0] WHERE NOT (EXISTS( SELECT NULL AS [EMPTY] FROM [dbo].[ReceivedUpdatedRows] AS [t1] WHERE ([t1].[StudioId] = @p0) AND ([t1].[UpdatedRowId] = [t0].[Id]) ))',N'@p0 uniqueidentifier',@p0='" + this.studioId.ToString() + "'; and exec sp_executesql N'INSERT INTO HQ.dbo.ReceivedUpdatedRows ([UpdatedRowId], [StudioId], [ReceiveDateTime]) SELECT [t0].[UpdatedRowId], @p0, GETDATE() FROM [dbo].[SynchronizingRows] AS [t0] WHERE ([t0].[StudioId] = @p0)',N'@p0 uniqueidentifier',@p0='" + this.studioId.ToString() + "'; The basic logic of my (client-server) application is this: Every time someone inserts or updates a row on the server side, I also insert a row into the table UpdatedRows, specifying the RowId of the modified row. When a client tries to synchronize data, it first copies all of the rows in the UpdatedRows table, that don't contain a reference row for the specific client in the table ReceivedUpdatedRows, to the table SynchronizingRows (the first statement taking part in the deadlock). Afterwards, during the synchronization I look for modified rows via lookup of the SynchronizingRows table. This step is required, otherwise if someone inserts new rows or modifies rows on the server side during synchronization I will miss them and won't get them during the next synchronization (explanation scenario to long to write here...). Once synchronization is complete, I insert rows to the ReceivedUpdatedRows table specifying that this client has received the UpdatedRows contained in the SynchronizingRows table (the second statement taking part in the deadlock). Finally I delete all rows from the SynchronizingRows table that belong to the current client. The way I see it, the deadlock is occuring on tables SynchronizingRows (abbreviation SR) and ReceivedUpdatedRows (abbreviation RUR) during steps 2 and 3 (one client is in step 2 and is inserting into SR and selecting from RUR; while another client is in step 3 inserting into RUR and selecting from SR). I googled a bit about SQL deadlocks and came to a conclusion that I have three options. Inorder to make a decision I need more input about each option/workaround: Workaround 1: The first advice given on the web about SQL deadlocks - restructure tables/queries so that deadlocks don't happen in the first place. Only problem with this is that with my IQ I don't see a way to do the synchronization logic any differently. If someone wishes to dwelve deeper into my current synchronization logic, how and why it is set up the way it is, I'll post a link for the explanation. Perhaps, with the help of someone smarter than me, it's possible to create a logic that is deadlock free. Workaround 2: The second most common advice seems to be the use of WITH(NOLOCK) hint. The problem with this is that NOLOCK might miss or duplicate some rows. Duplication is not a problem, but missing rows is catastrophic! Another option is the WITH(READPAST) hint. On the face of it, this seems to be a perfect solution. I really don't care about rows that other clients are inserting/modifying, because each row belongs only to a specific client, so I may very well skip locked rows. But the MSDN documentaion makes me a bit worried - "When READPAST is specified, both row-level and page-level locks are skipped". As I said, row-level locks would not be a problem, but page-level locks may very well be, since a page might contain rows that belong to multiple clients (including the current one). While there are lots of blog posts specifically mentioning that NOLOCK might miss rows, there seems to be none about READPAST (never) missing rows. This makes me skeptical and nervous to implement it, since there is no easy way to test it (implementing would be a piece of cake, just pop WITH(READPAST) into both statements SELECT clause and job done). Can someone confirm whether the READPAST hint can miss rows? Workaround 3: The final option is to use ALLOW_SNAPSHOT_ISOLATION and READ_COMMITED_SNAPSHOT. This would seem to be the only option to work 100% - at least I can't find any information that would contradict with it. But it is a little bit trickier to setup (I don't care much about the performance hit), because I'm using LINQ. Off the top of my head I probably need to manually open a SQL connection and pass it to the LINQ2SQL DataContext, etc... I haven't looked into the specifics very deeply. Mostly I would prefer option 2 if somone could only reassure me that READPAST will never miss rows concerning the current client (as I said before, each client has and only ever deals with it's own set of rows). Otherwise I'll likely have to implement option 3, since option 1 is probably impossible... I'll post the table definitions for the three tables as well, just in case: CREATE TABLE [dbo].[UpdatedRows]( [Id] [uniqueidentifier] NOT NULL ROWGUIDCOL DEFAULT NEWSEQUENTIALID() PRIMARY KEY CLUSTERED, [RowId] [uniqueidentifier] NOT NULL, [UpdateDateTime] [datetime] NOT NULL, ) ON [PRIMARY] GO CREATE NONCLUSTERED INDEX IX_RowId ON dbo.UpdatedRows ([RowId] ASC) WITH (STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] GO CREATE TABLE [dbo].[ReceivedUpdatedRows]( [Id] [uniqueidentifier] NOT NULL ROWGUIDCOL DEFAULT NEWSEQUENTIALID() PRIMARY KEY NONCLUSTERED, [UpdatedRowId] [uniqueidentifier] NOT NULL REFERENCES [dbo].[UpdatedRows] ([Id]), [StudioId] [uniqueidentifier] NOT NULL REFERENCES, [ReceiveDateTime] [datetime] NOT NULL, ) ON [PRIMARY] GO CREATE CLUSTERED INDEX IX_Studios ON dbo.ReceivedUpdatedRows ([StudioId] ASC) WITH (STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] GO CREATE TABLE [dbo].[SynchronizingRows]( [StudioId] [uniqueidentifier] NOT NULL [UpdatedRowId] [uniqueidentifier] NOT NULL REFERENCES [dbo].[UpdatedRows] ([Id]) PRIMARY KEY CLUSTERED ([StudioId], [UpdatedRowId]) ) ON [PRIMARY] GO PS! Studio = Client. PS2! I just noticed that the index definitions have ALLOW_PAGE_LOCK=ON. If I would turn it off, would that make any difference to READPAST? Are there any negative downsides for turning it off?

    Read the article

  • Need help... how to add md5 to password field in php?

    - by jones
    Hi mates, i looking some help and nice attention here.. i bought some php script many years ago and now no suport anymore... i just want to add md5 to password field.. here my form: <?php $SQL = "SELECT * from USERS WHERE USERNAME = '$_SESSION[username]'"; $result = @mysql_query( $SQL ); $row = @mysql_fetch_array( $result ); include 'menu.php'; ?> <FORM METHOD="post" ACTION="?page=query_client"> <INPUT TYPE="hidden" NAME="controller" VALUE="USERS~update~account_details&up=1~<?php echo $row[ID]; ?>"> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdmenu" WIDTH="40%">Username</TD> <TD CLASS="tdmenu" WIDTH="60%"> <b><?php echo $row[USERNAME]; ?></b> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Password *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="PASSWORD" NAME="PASSWORD" SIZE="40" VALUE="<?php echo $row[PASSWORD]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Email Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="EMAIL" SIZE="40" VALUE="<?php echo $row[EMAIL]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Full Name *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="FULLNAME" SIZE="40" VALUE="<?php echo $row[FULLNAME]; ?>"> </TD> <TR> <TD CLASS="tdmenu" WIDTH="40%">Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="ADDRESS1" SIZE="40" VALUE="<?php echo $row[ADDRESS1]; ?>"> </TD> </TR> <BR> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdhead2" > <DIV ALIGN="CENTER"><B> <INPUT TYPE="submit" NAME="Submit" VALUE="Submit"> </B></DIV> </TD> </TR> </TABLE> </FORM> and the it self as query_client.php inside look like: <?PHP @session_start(); $controller = $_POST['controller']; $pieces = explode("~", $controller); $table = $pieces[0]; $qt = $pieces[1]; $return = $pieces[2]; $id = $pieces[3]; $hack = $pieces[4]; if ($qt == insert) $qt = 'INSERT INTO'; if ($qt == update) { $qt = 'UPDATE'; $end = "WHERE ID = '$id'"; } $pre = array_keys( $_POST ); mysql_query ("CREATE TABLE IF NOT EXISTS `$table` (`ID` INT NOT NULL AUTO_INCREMENT , PRIMARY KEY ( `id` ) )"); $count = count($pre); $count = $count - 2; $sql = "$qt $table SET"; for ($i=0; $i < $count; $i++) { $x=$i+1; $y = $_POST[$pre[$x]]; $d = $y; mysql_query ("ALTER TABLE `$table` ADD `$pre[$x]` TEXT NOT NULL"); $sql .= " `$pre[$x]` = '$d',"; } $sql .= " ID = '$id' $end"; $query = mysql_query($sql) or die("$sql_error" . mysql_error()); if (empty($hack)) { } else { $pieces = explode("/", $hack); $h0 = $pieces[0]; $h1 = $pieces[1]; $h2 = $pieces[2]; $h3 = $pieces[3]; $h4 = $pieces[4]; $h5 = $pieces[5]; mysql_query ("ALTER TABLE `$table` $h0 $h1 $h2 $h3 $h4 $h5"); $query = mysql_query($sql) or die("$sql_error" . mysql_error()); } if (isset($_GET[inc])) include "$_GET[inc].php"; ?> so please help me how to add md5 in PASSWORD field? thanks in advance..

    Read the article

  • How to correctly use DERIVE or COUNTER in munin plugins

    - by Johan
    I'm using munin to monitor my server. I've been able to write plugins for it, but only if the graph type is GAUGE. When I try COUNTER or DERIVE, no data is logged or graphed. The plugin i'm currently stuck on is for monitoring bandwidth usage, and is as follows: /etc/munin/plugins/bandwidth2 #!/bin/sh if [ "$1" = "config" ]; then echo 'graph_title Bandwidth Usage 2' echo 'graph_vlabel Bandwidth' echo 'graph_scale no' echo 'graph_category network' echo 'graph_info Bandwidth usage.' echo 'used.label Used' echo 'used.info Bandwidth used so far this month.' echo 'used.type DERIVE' echo 'used.min 0' echo 'remain.label Remaining' echo 'remain.info Bandwidth remaining this month.' echo 'remain.type DERIVE' echo 'remain.min 0' exit 0 fi cat /var/log/zen.log The contents of /var/log/zen.log are: used.value 61.3251953125 remain.value 20.0146484375 And the resulting database is: <!-- Round Robin Database Dump --><rrd> <version> 0003 </version> <step> 300 </step> <!-- Seconds --> <lastupdate> 1269936605 </lastupdate> <!-- 2010-03-30 09:10:05 BST --> <ds> <name> 42 </name> <type> DERIVE </type> <minimal_heartbeat> 600 </minimal_heartbeat> <min> 0.0000000000e+00 </min> <max> NaN </max> <!-- PDP Status --> <last_ds> 61.3251953125 </last_ds> <value> NaN </value> <unknown_sec> 5 </unknown_sec> </ds> <!-- Round Robin Archives --> <rra> <cf> AVERAGE </cf> <pdp_per_row> 1 </pdp_per_row> <!-- 300 seconds --> <params> <xff> 5.0000000000e-01 </xff> </params> <cdp_prep> <ds> <primary_value> NaN </primary_value> <secondary_value> NaN </secondary_value> <value> NaN </value> <unknown_datapoints> 0 </unknown_datapoints> </ds> </cdp_prep> <database> <!-- 2010-03-28 09:15:00 BST / 1269764100 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:20:00 BST / 1269764400 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:25:00 BST / 1269764700 --> <row><v> NaN </v></row> <snip> The value for last_ds is correct, it just doesn't seem to make it into the actual database. If I change DERIVE to GAUGE, it works as expected. munin-run bandwidth2 outputs the contents of /var/log/zen.log I've been all over the (sparse) docs for munin plugins, and can't find my mistake. Modifying an existing plugin didn't work for me either.

    Read the article

  • why use mixed-based replication for mysql

    - by Alistair Prestidge
    I am in the process of configuring MySQL replication and am intending to use row-based-replication but I was also reading up about mixed-based replication. This is where statement-based is the default and then for certain circumstances (http://dev.mysql.com/doc/refman/5.1/en/binary-log-mixed.html) MySQL will switch to row-based. The list is quit vast on when it will switch to row-based. My questions are: Does any one use mixed? If yes why did you chose this over just using one or the other? Thanks in advance

    Read the article

  • Merging multiple versions of same excel spreadsheet

    - by GrinReaper
    So here's the situation: I have multiple versions of the same spreadsheet-- each one has the exact same row and column labels. The difference between any two given spreadsheets is that data in one spreadsheet shouldn't be in the other (but sometimes it might.) Is there anyway to merge all of them into a "master copy" (or just a blank version) of the spreadsheet? (basically, using the data from various versions of that worksheet to fill out the main one) Copy-pasting is extremely tedious, and doesn't allow me to copy blocks of rows IF the row numbering is non-contiguous. (For example, Rows 1, 2, 3, 6 are in a block, but row 4 and 5 just don't exist.) Ideas? Googling hasn't turned up anything that seemed directly relevant to this problem.

    Read the article

  • conditional formatting for subsequent rows or columns

    - by Trailokya Saikia
    I have data in a range of cells (say six columns and one hundred rows). The first four column contains data and the sixth column has a limiting value. For data in every row the limiting value is different. I have one hundred such rows. I am successfully using Conditional formatting (e.g. cells containing data less than limiting value in first five columns are made red) for 1st row. But how to copy this conditional formatting so that it is applicable for entire hundred rows with respective limiting values. I tried with format painter. But it retains the same source cell (here limiting value) for the purpose of conditional formatting in second and subsequent rows. So, now I am required to use conditional formatting for each row separately s

    Read the article

  • How do I extract excel data from multiple worksheets and put into one sheet?

    - by user167210
    In a workbook I have 7 sheets(Totals and then Mon to Sat),I want to extract rows which have the word "CHEQ" in its cell (this is a dropdown list with two options-CHEQ/PAID)from all sheets. On my front sheet I used this formula: =IF(ROWS(A$13:A13)>$C$10,"",INDEX(Monday!A$3:A$62,SMALL(IF(Monday[Paid]=$A$10,ROW(Monday[Paid])-ROW(Monday!$I$3)+1),ROWS(A$13:A13)))) This formula works fine for one worksheet (eg. Monday) but is it possible to show the extracted rows from all 6 sheets on the front page? I only have Excel NOT Access. These are the 12 headers on row A12 Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted The exported data appears like this (this just an example): Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted 12 Robbs 1244 Ren 11/10 10% 5 CHEQ 0 0 No 15 Jones 7784 Ren 12/10 15% 1 CHEQ 0 0 No 18 Doese 1184 Ren 12/11 12% 1 CHEQ 0 0 No Any ideas on what to do to this formula? I am using Excel 2010.

    Read the article

  • In Excel, given a worksheet "A", how do you create a sheet "B" that has a subset of the rows in "A"?

    - by user32706
    In Excel 2007, I have a sheet full of data "A". One of the columns in sheet "B" is called "Valid" and has either "yes" or "no". I've created a second sheet "B". It's easy to make each row in "A" appear in "B" if the row is valid using an 'if' statement in each cell. But if it's invalid, there's a blank row. I need "B" to show only the rows from "A" that are valid. TWO BIG CAVEATS: - No macros - No filtering (for long and complicated reasons). I feel like it might be possible with vlookup used cleverly, but so far, I'm stumped.

    Read the article

  • Nested IF's in Excel

    - by user1590499
    I have two columns with the following possibilities (0 for first column, and then 0 or 1 for second column; or a string for first column, and a 0 or 1 for second column). name,flag 0,0 david,0 0,1 sammy,1 How would I create a third column that looks like the following: name+flag 0 david 1 sammy Basically, if there are 2 0's in the two columns in a row, put a 0 in the new column. if there is a string in the first column in the row, no matter what the second column in the row says, put the string in the new column. and if there is a 0 in the first column and a 1 on the second column, put a 1 in the third column. Can I do this best with nested-if's? I tried something like name, flag, name+flag 0,0,=IF(A2<>0,A2,IF(B2=1,B2,0),0) But it didn't seem to work for me...

    Read the article

  • Can't insert cells in Excel 2010 - "operation not allowed" error message

    - by Force Flow
    I was working on a spreadsheet in Excel 2010, and all of a sudden when I attempted to insert a new row of cells, I saw that the insert and delete options were grayed out. I attempted to copy a different row and insert it as a new row, but I got the error message: "This operation is not allowed. The operation is attempting to shift cells in a table on your worksheet." I have not merged or hidden any cells/rows/columns. There are no formulas. There is no data verification. I tried closing and re-opening the spreadsheet. Searching for answers brings up nothing useful.

    Read the article

  • How to link data in different worksheets

    - by user2961726
    I tried consolidation but I can not get the following to work as it keeps saying no data consolidated. Can somebody try this dummy application and if they figure out how to do the following below can give me a step by step guide so I can attempt myself to learn. I'm not sure if I need to use any coding for this: In the dummy application I have 2 worksheets. One known as "1st", the other "Cases". In the "1st" worksheet you can insert and delete records for the "Case" table at the bottom, what I want to do is insert a row into the Case Table in worksheet "1st" and enter in the data for that row. What should happen is that data should be automatically be updated in the table in the "Cases" worksheet. But I can't seem to get this to work. Also if I delete a row from the table in Worksheet "1st" it should automatically remove that record from the "Cases" worksheet table. Please help. Below is the spreadsheet: http://ge.tt/8sjdkVx/v/0

    Read the article

  • Repeat the csv header twice without "Append" (PowerShell 1.0)

    - by Mark
    I have prepared a PowerShell script to export a list of system users in CSV format. The script can output the users list with Export-csv with single header row (the header row at top). However my requirement is to repeat the header row twice in my file. It is easy to achieve in PowerShell 3.0 with "Append" (e.g. $header | out-file $filepath -Append) Our server envirnoment is running PowerShell 1.0. Hence I cannot do it. Is there any workaround? I cannot manually add it myself. Thank you.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >