Search Results

Search found 4011 results on 161 pages for 'automated printing'.

Page 101/161 | < Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >

  • MS Access Print Report using VBA

    - by LanguaFlash
    I have a very VBA intensive report. When I preview it everything is great but when I print it after previewing things go wacky. I have spent many hours narrowing down the possibilities and I have conclude with a certain level of confidence that it is a but in MS Access. Up to this point my method for printing reports was to open the report using docmd.openreport "report". I then use the docmd.printout command so that I can set the page range, collation etc. Is there a way to print a report directly and still be able to set options like page rage, collate etc without doing a preview first? Thanks, Jeff

    Read the article

  • how to serialize / deserialize classes defined in .proto (protobuf)

    - by make
    Hi, Could someone please help me with serialization/deserialization classes defined in .proto (protobuf). here is an exp that I am trying to build: file.proto message Data{ required string x1 = 1; required uint32 x2 = 2; required float x3 = 3; } message DataExge { repeated Data data = 1; } client.cpp ... void serialize(const DataExge &data_snd){ try { ofstream ofs("DataExge"); data_snd.SerializeToOstream(&ofs); } catch(exception &e) { cerr << "serialize/exception: " << e.what() << endl; exit(1); } } void deserialize(DataExge &data_rec){ try { ifstream ifs("DataExge"); data_rec.ParseFromIstream(&ifs); } catch(exception& e) { cerr << "deserialize/exception: " << e.what() << endl; exit(1); } } int main(){ ... DataExge dataexge; Data *dat = dataexge.add_data(); char *y1 = "operation1"; uint32_t y2 = 123 ; float y3 = 3.14; // assigning data to send() dat->set_set_x1(y1); dat->set_set_x2(y2); dat->set_set_x3(y3); //sending data to the client serialize(dataexge); if (send(socket, &dataexge, sizeof(dataexge), 0) < 0) { cerr << "send() failed" ; exit(1); } //receiving data from the server deserialize(dataexge); if (recv(socket, &dataexge, sizeof(dataexge), 0) < 0) { cerr << "recv() failed"; exit(1); } //printing received data cout << dat->x1() << "\n"; cout << dat->x2() << "\n"; cout << dat->x3() << "\n"; ... } server.cpp ... void serialize(const DataExge &data_snd){ try { ofstream ofs("DataExge"); data_snd.SerializeToOstream(&ofs); } catch(exception &e) { cerr << "serialize/exception: " << e.what() << endl; exit(1); } } void deserialize(DataExge &data_rec){ try { ifstream ifs("DataExge"); data_rec.ParseFromIstream(&ifs); } catch(exception& e) { cerr << "deserialize/exception: " << e.what() << endl; exit(1); } } int main(){ ... DataExge dataexge; Data *dat = dataexge.add_data(); //receiving data from the client deserialize(dataexge); if (recv(socket, &dataexge, sizeof(dataexge), 0) < 0) { cerr << "recv() failed"; exit(1); } //printing received data cout << dat->x1() << "\n"; cout << dat->x2() << "\n"; cout << dat->x3() << "\n"; // assigning data to send() dat->set_set_x1("operation2"); dat->set_set_x2(dat->x2() + 1); dat->set_set_x3(dat->x3() + 1.1); //sending data to the client serialize(dataexge); //error// I am getting error at this line ... if (send(socket, &dataexge, sizeof(dataexge), 0) < 0) { cerr << "send() failed" ; exit(1); } ... } Thanks for your help and replies -

    Read the article

  • How do I format an email for Gmail?

    - by Ethan
    Hey, I'm sending out an email using codeigniter's built in library. All I'm trying to do is send a bolded string, but instead of rendering the tags, it is printing them. What I have: <html> <head> </head> <body> <b>Donkey</b> </body> </html> That is, character for character, the email I'm getting. Why aren't the tags rendering? Thanks for your help!

    Read the article

  • Source code of books made with TeX/LaTeX to learn

    - by Diego Sevilla
    Some time ago, reading this entry I found a nice image and a pointer to a better book entitled "Thinking Forth". To my surprise, the LaTeX sources of the book were ready to download, with pearls like: %% There's no bold typewriter in Computer Modern. %% Emulate with printing several times, slightly moving \newdimen\poormove \poormove0.0666pt \newcommand{\poorbf}[1]{% \llap{\hbox to \poormove{#1\hss}}% \raise\poormove\rlap{#1\hss}% \lower\poormove\rlap{#1\hss}% \rlap{\hbox to \poormove{\hss}\hbox{#1}}% #1} %\let\poorbf=\textbf \renewcommand{\poorbf}[1]{{\fontencoding{OT1}\fontfamily{cmtt}\fontseries{b}\selectfont#1}} in which it can simulate the bold stroking of a font that doesn't have it. Since reading that, I was unaware of \llap and such, but now I can use them to define boxes, etc. So, my question is twofold: Do you know of sites that show that relatively advanced use of TeX/LaTeX in terms of useful recipes, and Do you know any books that offer their TeX/LaTeX source to inspect and learn (and that are worth doing so.)?

    Read the article

  • retriving hearders in all pages of word

    - by udaya
    Hi I am exporting data from php page to word,, there i get 'n' number of datas in each page .... How to set the maximum number of data that a word page can contain ,,,, I want only 20 datas in a single page This is the coding i use to export the data to word i got the data in word format but the headers are not available for all the pages ex: Page:1 slno name country state Town 1 vivek india tamilnadu trichy 2 uday india kerala coimbatore like this i am getting many details but in my page:2 i dont get the headers like name country state and town....But i can get the details like kumar america xxxx yyyy i want the result to be like slno name country state town n chris newzealand ghgg jkgj Can i get the headers If it is not possible Is there anyway to limit the number of details being displayed in each page //EDIT YOUR MySQL Connection Info: $DB_Server = "localhost"; //your MySQL Server $DB_Username = "root"; //your MySQL User Name $DB_Password = ""; //your MySQL Password $DB_DBName = "cms"; //your MySQL Database Name $DB_TBLName = ""; //your MySQL Table Name $sql = "SELECT (SELECT COUNT(*) FROM tblentercountry t2 WHERE t2.dbName <= t1.dbName and t1.dbIsDelete='0') AS SLNO ,dbName as Namee,t3.dbCountry as Country,t4.dbState as State,t5.dbTown as Town FROM tblentercountry t1 join tablecountry as t3, tablestate as t4, tabletown as t5 where t1.dbIsDelete='0' and t1.dbCountryId=t3.dbCountryId and t1.dbStateId=t4.dbStateId and t1.dbTownId=t5.dbTownId order by dbName limit 0,50"; //Optional: print out title to top of Excel or Word file with Timestamp //for when file was generated: //set $Use_Titel = 1 to generate title, 0 not to use title $Use_Title = 1; //define date for title: EDIT this to create the time-format you need //$now_date = DATE('m-d-Y H:i'); //define title for .doc or .xls file: EDIT this if you want $title = "Country"; /* Leave the connection info below as it is: just edit the above. (Editing of code past this point recommended only for advanced users.) */ //create MySQL connection $Connect = @MYSQL_CONNECT($DB_Server, $DB_Username, $DB_Password) or DIE("Couldn't connect to MySQL:" . MYSQL_ERROR() . "" . MYSQL_ERRNO()); //select database $Db = @MYSQL_SELECT_DB($DB_DBName, $Connect) or DIE("Couldn't select database:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //execute query $result = @MYSQL_QUERY($sql,$Connect) or DIE("Couldn't execute query:" . MYSQL_ERROR(). "" . MYSQL_ERRNO()); //if this parameter is included ($w=1), file returned will be in word format ('.doc') //if parameter is not included, file returned will be in excel format ('.xls') IF (ISSET($w) && ($w==1)) { $file_type = "vnd.ms-excel"; $file_ending = "xls"; }ELSE { $file_type = "msword"; $file_ending = "doc"; } //header info for browser: determines file type ('.doc' or '.xls') HEADER("Content-Type: application/$file_type"); HEADER("Content-Disposition: attachment; filename=database_dump.$file_ending"); HEADER("Pragma: no-cache"); HEADER("Expires: 0"); /* Start of Formatting for Word or Excel */ IF (ISSET($w) && ($w==1)) //check for $w again { /* FORMATTING FOR WORD DOCUMENTS ('.doc') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\n"; //new line character WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { //define field names $field_name = MYSQL_FIELD_NAME($result,$j); //will show name of fields $schema_insert .= "$field_name:\t"; IF(!ISSET($row[$j])) { $schema_insert .= "NULL".$sep; } ELSEIF ($row[$j] != "") { $schema_insert .= "$row[$j]".$sep; } ELSE { $schema_insert .= "".$sep; } } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); //end of each mysql row //creates line to separate data from each MySQL table row PRINT "\n----------------------------------------------------\n"; } }ELSE{ /* FORMATTING FOR EXCEL DOCUMENTS ('.xls') */ //create title with timestamp: IF ($Use_Title == 1) { ECHO("$title\n"); } //define separator (defines columns in excel & tabs in word) $sep = "\t"; //tabbed character //start of printing column names as names of MySQL fields FOR ($i = 0; $i < MYSQL_NUM_FIELDS($result); $i++) { ECHO MYSQL_FIELD_NAME($result,$i) . "\t"; } PRINT("\n"); //end of printing column names //start while loop to get data WHILE($row = MYSQL_FETCH_ROW($result)) { //set_time_limit(60); // HaRa $schema_insert = ""; FOR($j=0; $j<mysql_num_fields($result);$j++) { IF(!ISSET($row[$j])) $schema_insert .= "NULL".$sep; ELSEIF ($row[$j] != "") $schema_insert .= "$row[$j]".$sep; ELSE $schema_insert .= "".$sep; } $schema_insert = STR_REPLACE($sep."$", "", $schema_insert); //following fix suggested by Josue (thanks, Josue!) //this corrects output in excel when table fields contain \n or \r //these two characters are now replaced with a space $schema_insert = PREG_REPLACE("/\r\n|\n\r|\n|\r/", " ", $schema_insert); $schema_insert .= "\t"; PRINT(TRIM($schema_insert)); PRINT "\n"; } } ?

    Read the article

  • I want the "default printer name" on the client's computer to print the Crystal ReportViewer Content

    - by indira prasad
    I want the "default printer name" on the client's computer to print the Crystal ReportViewer Content My Code : printDocument = new System.Drawing.Printing.PrintDocument(); int nCopy = printDocument.PrinterSettings.Copies; int sPage = printDocument.PrinterSettings.FromPage; int ePage = printDocument.PrinterSettings.ToPage; string PrinterName = printDocument.PrinterSettings.PrinterName; rpt = (ReportDocument)Session["Report"]; rpt.PrintOptions.PrinterName = PrinterName; rpt.PrintToPrinter(nCopy, false, sPage, ePage); It is working fine locally but when I host the Application in IIS, that printer name it is taking default 'Microsoft XPS Document Writer' . thanks in advance.

    Read the article

  • Prolog n00b question: Doing whatever

    - by dmindreader
    I want to load this simple something into my Editor: Write:-repeat,write("hi"),nl,fail. So that it prints "hi". What should I do? I'm currently trying to do File->New and Saving a file named Write into E:\Program Files\pl\xpce\prolog\lib When doing the query: ?-Write. It's printing: 1 ?- Write. % ... 1,000,000 ............ 10,000,000 years later % % >> 42 << (last release gives the question) Why?

    Read the article

  • How to print non-ASCII characters in Python

    - by Roman
    I have a problem when I'm printing (or writing to a file) the non-ASCII characters in Python. I've resolved it by overriding the str method in my own objects, and making "x.encode('utf-8')" inside it, where x is a property inside the object. But, if I receive a third-party object, and I make "str(object)", and this object has a non-ASCII character inside, it will fail. So the question is: is there any way to tell the str method that the object has an UTF-8 codification, generically? I'm working with Python 2.5.4.

    Read the article

  • Problem in Report Design Layout

    - by Prasanna
    Hi, I have a jasper report with 4 subreports in the detail band of the master report. If data is available for first subreport, it starts displaying from page 1 with the header of the subreport. When second subreport starts printing data, it prints only header in page 1 and the page breaks and in the page 2, it prints header again n data for that. I dont want the header of the second subreport to be printed in page1. It should start print in the page 2. How to solve this..? How could i page break...? its urgent.Please help. Thanks in advance, Prasanna

    Read the article

  • Can a http server detect that a client has cancelled their request?

    - by Nick Retallack
    My web app must process and serve a lot of data to display certain pages. Sometimes, the user closes or refreshes a page while the server is still busy processing it. This means the server will continue to process data for several minutes only to send it to a client who is no longer listening. Is it possible to detect that the connection has been broken, and react to it? In this particular project, we're using Django and NginX, or Apache. I assumed this is possible because the Django development server appears to react to cancelled requests by printing Broken Pipe exceptions. I'd love to have it raise an exception that my application code could catch. Alternatively, I could register an unload event handler on the page in question, have it do a synchronous XHR requesting that the previous request from this user be cancelled, and do some kind of inter-process communication to make it so. Perhaps if the slower data processing were handed to another process that I could more easily identify and kill, without killing the responding process...

    Read the article

  • View print CSS in IE7 or IE8

    - by RVanasse
    I'm debugging a site that has problems with element positioning when printing (I have a separate print.css file linked by a link element with the media="print" attribute). This problem only occurs in IE7 and IE8. What I'm looking for is a way to view the page using the print media type, but while still having IE8's developer tools available to view element details and edit in real-time, etc. The function I'm looking for would be similar to the "Display CSS by Media Type" feature in Chris Pederick's Web Developer Extension for Firefox. (But this problem doesn't occur in firefox...nor in safari, or even in IE6.)

    Read the article

  • All possible values of int from the smallest to the largest, using Java.

    - by Totophil
    Write a program to print out all possible values of int data type from the smallest to the largest, using Java. Some notable solutions as of 8th of May 2009, 10:44 GMT: 1) Daniel Lew was the first to post correctly working code. 2) Kris has provided the simplest solution for the given problem. 3) Tom Hawtin - tackline, came up arguably with the most elegant solution. 4) mmyers pointed out that printing is likely to become a bottleneck and can be improved through buffering. 5) Jay's brute force approach is notable since, besides defying the core point of programming, the resulting source code takes about 128 GB and will blow compiler limits. As a side note I believe that the answers do demonstrate that it could be a good interview question, as long as the emphasis is not on the ability to remember trivia about the data type overflow and its implications (that can be easily spotted during unit testing), or the way of obtaining MAX and MIN limits (can easily be looked up in the documentation) but rather on the analysis of various ways of dealing with the problem.

    Read the article

  • How do I get the size of a response from a Spring 2.5 HTTP remoting call?

    - by aarestad
    I've been poking around the org.springframework.remoting.httpinvoker package in Spring 2.5 trying to find a way to get visibility into the size of the response, but I keep going around in circles. Via another question I saw here, I think what I want to do is get a handle on the InputStream that represents the response from the server, and then wrap it with an Apache commons-io CountingInputStream. What's the best way to go about doing this? For the moment, I'd be happy with just printing the size of the response to stdout, but eventually I want to store it in a well-known location in my app for optional display.

    Read the article

  • Dynamically creating a member ID card as pdf using PHP?

    - by aefxx
    I need to code a PHP script that would let me generate a pdf file which displays a member ID card (something like a credit card used to identify oneself) at a certain resolution. Let me explain: I do have the basic blueprint of the card in png file format. The script needs to drop in a member's name and birthday along with a serial. So far, no problem - there are plenty of good working PHP libraries out there. My problem is to ensure that the resulting pdf (the generated image of the card, to be precise) meets a certain resolution (preferably 300dpi), so that printing it would look right. Any ideas? EDIT I solved it using the TCPDF library which lets you scale images at a certain resolution. Get it here: http://www.tecnick.com/public/code/cp_dpage.php?aiocp_dp=tcpdf

    Read the article

  • java updating text area

    - by n0ob
    for my application I have to build a little customized time ticker which ticks over after whatever delay I tell it to and writes the new value in my textArea. The problem is that the ticker is running fully until the termination time and then printing all the values. How can I make the text area change while the code is running. while(tick<terminationTime){ if ((System.currentTimeMillis()) > (msNow + delay)){ msNow = System.currentTimeMillis(); tick = tick + 1; currentTime.setText(""+tick); sourceTextArea.append(""+tick+" " + System.currentTimeMillis() +" \n"); } currentTime and sourceTextArea are both text areas and both are getting updated after the while loop ends.

    Read the article

  • flex3 Format date without timezone

    - by Maurits de Boer
    I'm receiving a date from a server in milliseconds since 1-1-1970. I then use the DateFormatter to print the date to the screen. However, Flex adds timedifference and thus it displays a different time than what I got from the server. I've fixed this by changing the date before printing to screen. But I think that's a bad solution because the date object doesn't hold the correct date. Does anyone know how to use the dateFormatter to print the date, ignoring the timezone? this is how I did it: function getDateString(value:Date):String { var millisecondsPerMinute:int = 1000*60; var newDate:Date = new Date(value.time - (millisecondsPerMinute*value.timezoneOffset)); var dateFormatter:DateFormatter = new DateFormatter(); dateFormatter.formatString = "EEEE DD-MM-YYYY LL:MM AA"; return dateFormatter.format(newDate); }

    Read the article

  • Floor function returning EXC_BAD_ACCESS

    - by fastrack20
    The cod that I am using contains these snippets of code. I am calling ThetaG_JD with the argument 2455343.50000 which is just a sample Julian date. Every time I run the program, I receive a EXC_BAD_ACCESS on the indicated line. When using gdb and printing out the intermediary values and passing them through the floor function, I get no error, but when Frac() is used it always returns an error. double Frac(double arg) { /* Returns fractional part of double argument */ return arg - floor(arg); } double ThetaG_JD(double jd) { /* Reference: The 1992 Astronomical Almanac, page B6. */ double UT=0, TU=0, GMST=0; //THIS LINE UT=Frac(jd+0.5); // THAT ONE ^^ jd=jd-UT; TU=(jd-2451545.0)/36525; GMST=24110.54841+TU*(8640184.812866+TU*(0.093104-TU*6.2E-6)); GMST=Modulus(GMST+secday*omega_E*UT,secday); return (twopi*GMST/secday); }

    Read the article

  • PostScript versus PDF as an output format

    - by Brecht Machiels
    I'm currently writing a typesetting application and I'm using PSG as the backend for producing postscript files. I'm now wondering whether that choice makes sense. It seems the ReportLab Toolkit offers all the features PSG offers, and more. ReportLab outputs PDF however. Advantages PDF offers: transparancy better support for character encodings (Unicode, for example) ability to embed TrueType and even OpenType fonts hyperlinks and bookmarks Is there any reason to use Postscript instead of directly outputting to PDF? While Postscript is a full programming language as opposed to PDF, as a basic output format for documents, that doesn't seem to offer any advantage. I assume a PDF can be readily converted to PostScript for printing? Some useful links: Wikipedia: PDF Adobe: PostScript vs. PDF

    Read the article

  • ASP.NET MVC AJAX value not displaying

    - by mazhar kaunain baig
    View: function success(arg) { var obj = arg.get_response().get_object(); if (obj.ErrorMessage === '') { var answer = document.createElement('div'); answer.appendChild(document.createTextNode(obj.Answer)); document.getElementById('answers').appendChild(answer); } else { document.getElementById('errors').innerHTML = obj.ErrorMessage; } } <% using (Ajax.BeginForm("EditOrganizationMeta", "Organization", new AjaxOptions { HttpMethod = "POST", OnSuccess = "success" })) { %> <input type="submit" name="button<%=OrganizationMeta.vcr_MetaKey + Lang.int_LangId %>" value="Save" /> <div id="errors"></div> <div id="answers"></div> <% } %> Controller: [HttpPost] [ValidateInput(false)] public ActionResult EditOrganizationMeta(FormCollection collection) { return Json(new { Answer = "Record Successfully Saved", ErrorMessages = "Title is required" }); } The thing is that success method in the javascript is not getting the required parameters. It is printing undefined there. Is there a problem in javascript method OnSuccess?

    Read the article

  • Regarding BigDecimal

    - by arav
    i do the below java print command for this double variable double test=58.15; When i do a System.out.println(test); and System.out.println(new Double(test).toString()); It prints as 58.15. When i do a System.out.println(new BigDecimal(test)) I get the below value 58.14999999999999857891452847979962825775146484375 I am able to understand "test" double variable value is internally stored as 58.1499999. But when i do the below two System.out.println i am getting the output as 58.15 and not 58.1499999. System.out.println(test); System.out.println(new Double(test).toString()); It prints the output as 58.15 for the above two. Is the above System.out.println statements are doing some rounding of the value 58.1499999 and printing it as 58.15?

    Read the article

  • Handling Java stdout and stderr in Perl

    - by syker
    I am trying to run a Java program from my Perl script. I would like to avoid using System.exit(1) and System.exit(-1) commands in Java. I am however printing to STDOUT and STDERR from Java. In my Perl script, I am reading from Java's stdout and using that line by line output. How do I print stderr and fail if I ever see stderr? This is what I have so far: my $java_command = ...; open(DATA, ">$java_command"); while (<DATA>) { chomp($_); .... .... }

    Read the article

  • How do you printf an unsigned long long int?

    - by superjoe30
    #include <stdio.h>int main() { unsigned long long int num = 285212672; //FYI: fits in 29 bits int normalInt = 5; printf("My number is %d bytes wide and its value is %ul. A normal number is %d.\n", sizeof(num), num, normalInt); return 0;} Output: My number is 8 bytes wide and its value is 285212672l. A normal number is 0. I assume this unexpected result is from printing the unsigned long long int. How do you printf an unsigned long long int?

    Read the article

  • How to configure tomahawk and trinidad to work together

    - by ashtaganesh
    Hi, I am new to JSF. I want to use inputListOfValues component from Trinidad in my application which also uses Tomahawk. I have added the required jars for Trinidad and before getting inputListOfValues I tried one simple inputText to be printed on browser using Trinidad. I was not getting any configuration errors but it was not printing the corresponding text on browser. So I wonder if I can use tomahawk and trinidad together ? If yes, is there any configuration setting we need to do for this ? Any help will be greatly appreciated. Thanks, Ganesh.

    Read the article

  • Anybody know why the Output of this program is like this?(using iterator in c#)

    - by Babu
    using System; using System.Collections; namespace Iterator_test { class Day { int days_idx = -1; private String[] days = { "mon", "tue", "wed","thu","fri","sat","sun" }; public IEnumerable getdays() { days_idx++; yield return days[days_idx]; } } class Program { static void Main(string[] args) { Day d = new Day(); foreach (string day in d.getdays()) { Console.WriteLine(day); } } } } Actually the output should be, mon tue wed thu fri sat sun but its printing only "mon" as, mon What will be the reason?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >