Search Results

Search found 10194 results on 408 pages for 'raw types'.

Page 101/408 | < Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >

  • .Net SvcUtil: attributes must be optional

    - by Michel van Engelen
    Hi, I'm trying to generate C# code classes with SvcUtil.exe instead of Xsd.exe. The latter is giving me some problems. Command line: SvcUtil.exe myschema.xsd /dconly /ser:XmlSerializer Several SvcUtil problems are described and solved here: http://blog.shutupandcode.net/?p=761 One problem I can't solve is this one: Error: Type 'DatafieldDescription' in namespace '' cannot be imported. Attributes must be optional and from namespace 'http://schemas.microsoft.com/2003/10/Seri alization/'. Either change the schema so that the types can map to data contract types or use ImportXmlType or use a different serializer. ' I changed <xs:attribute name="Order" use="required"> to <xs:attribute name="Order" use="optional"> and <xs:attribute name="Order"> But the error remains. Is it possible to use attributes, or do I have to delete them all (in that case, this excercition is over)?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • Quick backup system for large projects

    - by kamziro
    I've always backed up all my source codes into .zip files and put it in my usb drive and uploaded to my server somewhere else in the world.. however I only do this once every two weeks, because my project is a little big. Right now my project directories (I have a few of them) contains a hierarchy of c++ files in it, and interspersed with them are .o files which would make backing up take a while if not ignored. What tools exist out there that will let me just back things up efficiently, conveniently and lets me specify which file types to back up (lots of .png, .jpg and some text types in there), and which directories to be ignored (esp. the build dirs)? Or is there any ingenious methods out there that people use?

    Read the article

  • Problems connecting Clariion LUNS to Solaris 10

    - by vialde
    I've got a Clariion San and a Solaris 10 server with an emulex HBA. The Thin LUNS are visible in Solaris and I can happily format the raw devices. Unfortunately that's all I can do. All other operations result in I/O errors. I'm running current versions of PowerPath and Solaris is patched as high as it'll go. Anyone have any similar experiences?

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Sort by an object's type

    - by Richard Levasseur
    Hi all, I have code that statically registers (type, handler_function) pairs at module load time, resulting in a dict like this: HANDLERS = { str: HandleStr, int: HandleInt, ParentClass: HandleCustomParent, ChildClass: HandleCustomChild } def HandleObject(obj): for data_type in sorted(HANDLERS.keys(), ???): if isinstance(obj, data_type): HANDLERS[data_type](obj) Where ChildClass inherits from ParentClass. The problem is that, since its a dict, the order isn't defined - but how do I introspect type objects to figure out a sort key? The resulting order should be child classes follow by super classes (most specific types first). E.g. str comes before basestring, and ChildClass comes before ParentClass. If types are unrelated, it doesn't matter where they go relative to each other.

    Read the article

  • Storing Templates and Object-Oriented vs Relational Databases

    - by syrion
    I'm designing some custom blog software, and have run into a conundrum regarding database design. The software requires that there be multiple content types, each of which will require different entry forms and presentation templates. My initial instinct is to create these content types as objects, then serialize them and store them in the database as JSON or YAML, with the entry forms and templates as simple strings attached to the "contentTypes" table. This seems cumbersome, however. Are there established best practices for dealing with this design? Is this a use case where I should consider an object database? If I should be using an object database, which should I consider? I am currently working in Python and would prefer a capable Python library, but can move to Java if need be.

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • Identifying that a variable is a new-style class in Python?

    - by Dave Johansen
    I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

    Read the article

  • Using static variable in function vs passing variable from caller

    - by Patrick
    I have a function which spawns various types of threads, one of the thread types needs to be spawned every x seconds. I currently have it like this: bool isTime( Time t ) { return t >= now(); } void spawner() { while( 1 ) { Time t = now(); if( isTime( t ) )//is time is called in more than one place in the real function { launchthread() t = now() + offset; } } } but I'm thinking of changing it to: bool isTime() { static Time t = now(); if( t >= now() ) { t = now() + offset; return true; } return false; } void spawner() { if( isTime() ) launchthread(); } I think the second way is neater but I generally avoid statics in much the same way I avoid global data; anyone have any thoughts on the different styles?

    Read the article

  • Good piece of software that can manage the creation of complex web forms, including reporting, etc?

    - by Callum
    I have some clients who are requesting for some of their reasonably complex paper-based forms to be converted in to web forms. There's straight Q&A text input stuff, there's questions based around checkboxes, radio boxes, select boxes, maybe the occasional attached image, there's data that has to be entered in a tabular fashion, etc. I am deciding whether I should build a "platform" with properly normalised tables to store all types of form data. But before that, I thought I had better check and see if there is anything like that already on the market. I am looking for a product that can: * Easily create web forms of all types * Store all data in a database * Extensive reporting capability I have had a bit of a look around but there's not a whole lot I can see. Does anyone have any suggestions? Thanks.

    Read the article

  • Descending list ordered by file modification time

    - by LanceBaynes
    How can I generate a list of files in a directory [for example, "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ But if a file is changed in a directory, it lists the full directory, so the pastebined link isn't good [I don't want a list ordered by "directories", I need a "per file" ordered list] OS: OpenWrt [no Perl - not enough space for it :( + no "stat", or "file" command].

    Read the article

  • How to keep group-writeable shares on Samba with OSX clients?

    - by Oliver Salzburg
    I have a FreeNAS server on a network with OSX and Windows clients. When the OSX clients interact with SMB/CIFS shares on the server, they are causing permission problems for all other clients. Update: I can no longer verify any answers because we abandoned the project, but feel free to post any help for future visitors. The details of this behavior seem to also be dependent on the version of OSX the client is running. For this question, let's assume a client running 10.8.2. When I mount the CIFS share on an OSX client and create a new directory on it, the directory will be created with drwxr-x-rx permissions. This is undesirable because it will not allow anyone but me to write to the directory. There are other users in my group which should have write permissions as well. This behavior happens even though the following settings are present in smb.conf on the server: [global] create mask= 0666 directory mask= 0777 [share] force directory mode= 0775 force create mode= 0660 I was under the impression that these settings should make sure that directories are at least created with rwxrwxr-x permissions. But, I guess, that doesn't stop the client from changing the permissions after creating the directory. When I create a folder on the same share from a Windows client, the new folder will have the desired access permissions (rwxrwxrwx), so I'm currently assuming that the problem lies with the OSX client. I guess this wouldn't be such an issue if you could easily change the permissions of the directories you've created, but you can't. When opening the directory info in Finder, I get the old "You have custom access" notice with no ability to make any changes. I'm assuming that this is caused because we're using Windows ACLs on the share, but that's just a wild guess. Changing the write permissions for the group through the terminal works fine, but this is unpractical for the deployment and unreasonable to expect from anyone to do. This is the complete smb.conf: [global] encrypt passwords = yes dns proxy = no strict locking = no read raw = yes write raw = yes oplocks = yes max xmit = 65535 deadtime = 15 display charset = LOCALE max log size = 10 syslog only = yes syslog = 1 load printers = no printing = bsd printcap name = /dev/null disable spoolss = yes smb passwd file = /var/etc/private/smbpasswd private dir = /var/etc/private getwd cache = yes guest account = nobody map to guest = Bad Password obey pam restrictions = Yes # NOTE: read smb.conf. directory name cache size = 0 max protocol = SMB2 netbios name = freenas workgroup = COMPANY server string = FreeNAS Server store dos attributes = yes hostname lookups = yes security = user passdb backend = ldapsam:ldap://ldap.company.local ldap admin dn = cn=admin,dc=company,dc=local ldap suffix = dc=company,dc=local ldap user suffix = ou=Users ldap group suffix = ou=Groups ldap machine suffix = ou=Computers ldap ssl = off ldap replication sleep = 1000 ldap passwd sync = yes #ldap debug level = 1 #ldap debug threshold = 1 ldapsam:trusted = yes idmap uid = 10000-39999 idmap gid = 10000-39999 create mask = 0666 directory mask = 0777 client ntlmv2 auth = yes dos charset = CP437 unix charset = UTF-8 log level = 1 [share] path = /mnt/zfs0 printable = no veto files = /.snap/.windows/.zfs/ writeable = yes browseable = yes inherit owner = no inherit permissions = no vfs objects = zfsacl guest ok = no inherit acls = Yes map archive = No map readonly = no nfs4:mode = special nfs4:acedup = merge nfs4:chown = yes hide dot files force directory mode = 0775 force create mode = 0660

    Read the article

  • How can I compress a movie to a specific file size in Windows 7's Live Movie Maker?

    - by Nathan Fellman
    In previous versions of Windows Movie Maker I could take a raw video file and specify the file size to compress it to, and Movie Maker would compress it accordingly (with the appropriate loss in quality). Live Movie Maker, which comes with Windows 7, doesn't seem to have this option. I can only set specify the requested quality. Is there any way to specify the size of the target file for Windows Live Movie Maker?

    Read the article

  • Grub Error 18 - Solid State Drive

    - by clint
    I recently used Raw Copy to make an image of my 300gb Raptor Hd to a OCZ Vertex SSD 60GB. And When I pluged in the SSD to boot I get a Grub Error 18. I have tried to changed in the BIOS setting to LBA, Large, Auto, trying different combination's. Any advice. thanks, Clint

    Read the article

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • Rails. Putting update logic in your migrations

    - by Daniel Abrahamsson
    A couple of times I've been in the situation where I've wanted to refactor the design of some model and have ended up putting update logic in migrations. However, as far as I've understood, this is not good practice (especially since you are encouraged to use your schema file for deployment, and not your migrations). How do you deal with these kind of problems? To clearify what I mean, say I have a User model. Since I thought there would only be two kinds of users, namely a "normal" user and an administrator, I chose to use a simple boolean field telling whether the user was an adminstrator or not. However, after I while I figured I needed some third kind of user, perhaps a moderator or something similar. In this case I add a UserType model (and the corresponding migration), and a second migration for removing the "admin" flag from the user table. And here comes the problem. In the "add_user_type_to_users" migration I have to map the admin flag value to a user type. Additionally, in order to do this, the user types have to exist, meaning I can not use the seeds file, but rather create the user types in the migration (also considered bad practice). Here comes some fictional code representing the situation: class CreateUserTypes < ActiveRecord::Migration def self.up create_table :user_types do |t| t.string :name, :nil => false, :unique => true end #Create basic types (can not put in seed, because of future migration dependency) UserType.create!(:name => "BASIC") UserType.create!(:name => "MODERATOR") UserType.create!(:name => "ADMINISTRATOR") end def self.down drop_table :user_types end end class AddTypeIdToUsers < ActiveRecord::Migration def self.up add_column :users, :type_id, :integer #Determine type via the admin flag basic = UserType.find_by_name("BASIC") admin = UserType.find_by_name("ADMINISTRATOR") User.all.each {|u| u.update_attribute(:type_id, (u.admin?) ? admin.id : basic.id)} #Remove the admin flag remove_column :users, :admin #Add foreign key execute "alter table users add constraint fk_user_type_id foreign key (type_id) references user_types (id)" end def self.down #Re-add the admin flag add_column :users, :admin, :boolean, :default => false #Reset the admin flag (this is the problematic update code) admin = UserType.find_by_name("ADMINISTRATOR") execute "update users set admin=true where type_id=#{admin.id}" #Remove foreign key constraint execute "alter table users drop foreign key fk_user_type_id" #Drop the type_id column remove_column :users, :type_id end end As you can see there are two problematic parts. First the row creation part in the first model, which is necessary if I would like to run all migrations in a row, then the "update" part in the second migration that maps the "admin" column to the "type_id" column. Any advice?

    Read the article

  • Recover harddrive data

    - by gameshints
    I have a dell laptop that recently "died" (It would get the blue screen of death upon starting) and the hard drive would make a weird cyclic clicking noises. I wanted to see if I could use some tools on my linux machine to recover the data, so I plugged it into there. If I run "fdisk" I get: Disk /dev/sdb: 20.0 GB, 20003880960 bytes 64 heads, 32 sectors/track, 19077 cylinders Units = cylinders of 2048 * 512 = 1048576 bytes Disk identifier: 0x64651a0a Disk /dev/sdb doesn't contain a valid partition table Fine, the partition table is messed up. However if I run "testdisk" in attempt to fix the table, it freezes at this point, making the same cyclical clicking noises: Disk /dev/sdb - 20 GB / 18 GiB - CHS 19078 64 32 Analyse cylinder 158/19077: 00% I don't really care about the hard drive working again, and just the data, so I ran "gpart" to figure out where the partitions used to be. I got this: dev(/dev/sdb) mss(512) chs(19077/64/32)(LBA) #s(39069696) size(19077mb) * Warning: strange partition table magic 0x2A55. Primary partition(1) type: 222(0xDE)(UNKNOWN) size: 15mb #s(31429) s(63-31491) chs: (0/1/1)-(3/126/63)d (0/1/32)-(15/24/4)r hex: 00 01 01 00 DE 7E 3F 03 3F 00 00 00 C5 7A 00 00 Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) (BOOT) size: 19021mb #s(38956987) s(31492-38988478) chs: (4/0/1)-(895/126/63)d (15/24/5)-(19037/21/31)r hex: 80 00 01 04 07 7E FF 7F 04 7B 00 00 BB 6F 52 02 So I tried to mount just to the old NTFS partition, but got an error: sudo mount -o loop,ro,offset=16123904 -t ntfs /dev/sdb /mnt/usb NTFS signature is missing. Ugh. Okay. But then I tried to get a raw data dump by running dd if=/dev/sdb of=/home/erik/brokenhd skip=31492 count=38956987 But the file got up to 59885568 bytes, and made the same cyclical clicking noises. Obviously there is a bad sector, but I don't know what to do about it! The data is still there... if I view that 57MB file in textpad... I can see raw data from files. How can I get my data back? Thanks for any suggestions, Solution: I was able to recover about 90% of my data: Froze harddrive in freezer Used Ddrescue to make a copy of the drive Since Ddrescue wasn't able to get enough of my drive to use testdisk to recover my partitions/file system, I ended up using photorec to recover most of my files

    Read the article

  • Sorting Table Cells based on data from NSArray

    - by Graeme
    Hi, I have an NSArray which contains information from an RSS feed on dogs, such as [dog types], [dog age] and [dog size]. At the moment my UITableView simply displays each cell on each dog and within the cell lists [dog types], [dog age] and [dog size]. I want to be able to allow users of my app to "sort" this data based on the dog name, dog size or dog age when they press a UIButton in the top nav-bar. I'm struggling to work out how to filter the UITableView based on these factors, so any help is appreciated. Thanks.

    Read the article

  • Sorting based on existing elements in xslt

    - by Teelo
    Hi , I want to sort in xslt based on existing set of pattern . Let me explain with the code: <Types> <Type> <Names> <Name>Ryan</Name> </Names> <Address>2344</Address> </Type> <Type> <Names> </Name>Timber</Name> </Names> <Address>1234</Address> </Type> <Type> <Names> </Name>Bryan</Name> </Names> <Address>34</Address> </Type> </Types> Right now I m just calling it and getting it like (all hyperlinks) Ryan Timber Bryan Now I don't want sorting on name but I have existing pattern how I want it to get displayed.Like Timber Bryan Ryan (Also I don't want to lose the url attached to my names earlier while doing this) I was thinking of putting earlier value in some array and sort based on the other array where I will store my existing pattern. But I am not sure how to achieve that.. My xslt looks like this now(there can be duplicate names also) <xsl:for-each select="/Types/Type/Names/Name/text()[generate-id()=generate-id(key('Name',.)[1])]"> <xsl:call-template name="typename"> </xsl:call-template> </xsl:for-each> <xsl:template name="typename"> <li> <a href="somelogicforurl"> <xsl:value-of select="."/> </a> </li> </xsl:template> I am using xsl 1.0

    Read the article

  • I need to monitor a physical RS232 port on an appliance?

    - by Kendor
    I need to verify what's being output on an RS232 port of an appliance that's running proprietary software (e.g. NOT Windows or Linux). The port is sending data to a target app on another appliance, but I need to verify/log the actual data raw outside of the appliances. Would appreciate a recommendation on process/software to attach to the physical sending port (I have a straight through RS232 cable) and grab sample output of that port.

    Read the article

  • What should layers in dotnet application ? Pleas guide me

    - by haansi
    Hi, I am using layered architecture in dotnet (mostly I work on web projects). I am confuse what layers should I use ? I have small idea that there should be the following layers. user interface customer types (custom entities) business logic layer data access layer My purpose is sure quality of work and maximum re-usability of code. some one suggested to add common types layer in it. Please guide me what should be layers ? and in each layer what part should go ? thanks for your precious time and advice. haansi

    Read the article

  • Double pointer const-correctness warnings in C

    - by Michael Koval
    You can obviously cast a pointer to non-const data to a a pointer of the same type to const data: int *x = NULL; int const *y = x; Adding additional const qualifiers to match the additional indirection should logically work the same way: int * *x = NULL; int *const *y = x; /* okay */ int const *const *z = y; /* warning */ Compiling this with GCC or Clang with the -Wall flag, however, results in the following warning: test.c:4:23: warning: initializing 'int const *const *' with an expression of type 'int *const *' discards qualifiers in nested pointer types int const *const *z = y; /* warning */ ^ ~ Why does adding an additional const qualifier "discard qualifiers in nested pointer types"?

    Read the article

< Previous Page | 97 98 99 100 101 102 103 104 105 106 107 108  | Next Page >