Search Results

Search found 1079 results on 44 pages for 'deepak kumar goyal'.

Page 11/44 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • How do I get Catalyst 11.10 with ATI Radeon Mobility HD 5470 working on an HP DV7?

    - by S Kumar
    I have a HP DV7 with a HD 5470 512M card. Installation of the Catalyst 11.10 is repeatedly failing on a fresh install of Ubuntu 11.10. Catalyst 11.8 proprietary drivers were working well with Ubuntu 11.04. I have tried installing directly from the .run and generating the distribution specific packages. Nothing has worked. After installation which goes through successfully, the system hangs on reboot after the flashing dots. I have to replace the /etc/X11/xorg.conf to get the X working. I have followed instructions as per the http://wiki.cchtml.com/index.php/Main_Page wiki. Request for support to ATI/AMD gives the response that this model is unsupported on Linux by HP :). Updated 14-Nov I have reverted back to the open source drivers which work well enough for me.

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to set BackGround color to a divider in JSplitPane

    - by Sunil Kumar Sahoo
    I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

    Read the article

  • UIImagePickerController dismissModalViewController

    - by Deepak Sharma
    I am trying to invoke UIImagePickerController to select a movie on iPhone 3GS and when the movie is selected, i just dismiss it and present MyViewController modally with a configured delay of 1.0 seconds. What I notice is 10% of the times, presentModalViewController on MyViewController does nothing whereas it works 90% of the times. I want to understand why is this behavior and what is the remedy. Here is the sample code: (void)imagePickerController:(UIImagePickerController *)picker didFinishPickingMediaWithInfo:(NSDictionary *)info { NSURL *videoURL = nil; NSString *mediaType = [info objectForKey:UIImagePickerControllerMediaType]; if ([mediaType isEqualToString:@"public.movie"]) { videoURL = [info objectForKey:UIImagePickerControllerMediaURL]; } picker.delegate = nil; [[picker parentViewController] dismissModalViewControllerAnimated:YES]; [self performSelector:@selector(launchMyViewController:) withObject:nil afterDelay:1.0]; } -(void) launchMyViewController:(id) obj { MyViewController *myCtrl = [[MyViewController alloc] initWithNibName:@"MyViewController" bundle:[NSBundle mainBundle] controller:self]; [self presentModalViewController:myCtrl animated:YES]; [myCtrl release]; NSLog(NSStringFromClass([self.modalViewController class])); [path release]; } I have put NSLog statement to print the self.modalViewController class name and what I notice is that 10% of the times when myCtrl is not fired modally, the self.modalViewController.class is UIImagePickerController. Otherwise, the self.modalViewController.class is MyViewController. I want to know why is the behavior so unpredictable and what is the workaround or other way to achieve the same thing I intend.

    Read the article

  • EAAccessory Notification problem

    - by Deepak
    Hi, I am using a POS device for card swipe. its working good. i have used following codes. (id) init { self = [super init]; if (self != nil) { NSNotificationCenter *notificationCenter = [NSNotificationCenter defaultCenter]; EAAccessoryManager *accessoryMamaner = [EAAccessoryManager sharedAccessoryManager]; [accessoryMamaner registerForLocalNotifications]; [notificationCenter addObserver: self selector: @selector (accessoryDidConnect:) name: EAAccessoryDidConnectNotification object: nil]; [notificationCenter addObserver: self selector: @selector (accessoryDidDisconnect:) name: EAAccessoryDidDisconnectNotification object: nil]; NSArray *accessories = [accessoryMamaner connectedAccessories]; accessory = nil; session = nil; for (EAAccessory *obj in accessories) { if ([[obj protocolStrings] containsObject:@"com.XXXXX"] || [[obj protocolStrings] containsObject:@"com.YYYYYY"] ) { accessory = obj; break; } } if (accessory) { session = [[EASession alloc] initWithAccessory:accessory forProtocol:@"com.dailysystems.DS247"]; if (!session) session = [[EASession alloc] initWithAccessory:accessory forProtocol:@"com.usaepay.ipos"]; if (session) { self.deviceConnected = YES; [[session inputStream] setDelegate:self]; [[session inputStream] scheduleInRunLoop:[NSRunLoop currentRunLoop] forMode:NSDefaultRunLoopMode]; [[session inputStream] open]; [[session outputStream] setDelegate:self]; [[session outputStream] scheduleInRunLoop:[NSRunLoop currentRunLoop] forMode:NSDefaultRunLoopMode]; [[session outputStream] open]; } else { UIAlertView *accessoryInfo = [[UIAlertView alloc] initWithTitle:@"Alert!" message:@"Hardware is not connected." delegate:nil cancelButtonTitle:@"OK" otherButtonTitles:nil]; [accessoryInfo show]; [accessoryInfo release]; } } } return self; } When i disconnect the accessory it gives me accessoryDidDisconnect and when i connect it gives me accessoryDidConnect, But Problem is after that accessory stop working it does not respond to command. i tried to release the alloc and alloc again but no use. Please tell me if some one have any idea how to get the accessory work again. Thanks in advance.

    Read the article

  • Adding WPF Text Writer Trace Listener in an Outlook Add In using wpf window/control

    - by Deepak N
    I'm working on a outlook 2003 AddIn using VSTO SE.We have few customized windows developed in WPF. It looks there are few client machines have problem with WPF rendering due to which there could be an exception due to addin is getting disabled. I added a outlook.exe.config and added trace listeners for wpf Trace sources. I set it up according this link. The console trace listener is working fine for me. But I'm not able get the TextWriterTraceListener working with config <add name="textListener" type="System.Diagnostics.TextWriterTraceListener" initializeData="Trace.log" /> I tried giving absolute path for trace log file as "C:\Trace.log".The TextWriterTraceListener worked for a dummy wpf app with the same config. Am I missing anything here.

    Read the article

  • Playing audio files in WPF

    - by deepak
    hai i need to play audio files in WPF am using the following code FileTextBox.Text = selectedFileName; MediaPlayer mp = new MediaPlayer(); mp.Open(new Uri(selectedFileName, UriKind.Relative )); mp.Play(); its working well, but it doesnt plays the sound. why ???

    Read the article

  • An exception occurred when setting up mail server parameters.: cfpop

    - by Deepak
    Hi, the below code was working till few days back, but all of the sudden it started giving exception <cfpop action="getall" name="qMessage" server="mail.forestweb.com" port="995" username="email***@industryintel.com" password="******" timeout="30" /> I am running this code every 10 minutes to fetch the emails. And getting following exceptions: Message: An exception occurred when setting up mail server parameters. Detail : This exception was caused by: javax.mail.MessagingException: Connect failed; nested exception is: java.net.SocketTimeoutException: Read timed out. Can anyone please tell me why this is happening and if it has any solutions. Thanks in advance!!

    Read the article

  • Compute the Length of Largest substring that starts and ends with the same substring

    - by Deepak
    Hi People, Below is the Problem Statement: PS: Given a string and a non-empty substring sub, compute recursively the largest substring which starts and ends with sub and return its length. Examples: strDist("catcowcat", "cat") ? 9 strDist("catcowcat", "cow") ? 3 strDist("cccatcowcatxx", "cat") ? 9 Below is my Code: (Without recursion)//since i found it hard to implement with recursion. public int strDist(String str, String sub){ int idx = 0; int max; if (str.isEmpty()) max = 0; else max=1; while ((idx = str.indexOf(sub, idx)) != -1){ int previous=str.indexOf(sub, idx); max = Math.max(max,previous); idx++; } return max; } Its working for few as shown below but returns FAIL for others. Expected This Run strDist("catcowcat", "cat") ? 9 6 FAIL strDist("catcowcat", "cow") ? 3 3 OK strDist("cccatcowcatxx", "cat") ? 9 8 FAIL strDist("abccatcowcatcatxyz", "cat") ? 12 12 OK strDist("xyx", "x") ? 3 2 FAIL strDist("xyx", "y") ? 1 1 OK strDist("xyx", "z") ? 0 1 FAIL strDist("z", "z") ? 1 1 OK strDist("x", "z") ? 0 1 FAIL strDist("", "z") ? 0 0 OK strDist("hiHellohihihi", "hi") ? 13 11 FAIL strDist("hiHellohihihi", "hih") ? 5 9 FAIL strDist("hiHellohihihi", "o") ? 1 6 FAIL strDist("hiHellohihihi", "ll") ? 2 4 FAIL Could you let me whats wrong with the code and how to return the largest substring that begins and ends with sub with its respective length.

    Read the article

  • Cannot install XML::LibXML module on Windows

    - by Deepak Konidena
    I am trying to use XPath to extract some HTML tags and data and for that I need to use XML::LibXML module. I tried installing it from CPAN shell but it doesn't install. I followed the instructions from CPAN site about the installation, that we need to install libxml2, iconv and zlib wrappers before installing XML::LibXML and it didn't work out. Also, if there is any other simpler module that gets my task done, please let me know. The task at hand: I am searching for a specific <dd> tag on a html page which is really big ( around 5000 - 10000) <dd> and <dt> tags. So, I am writing a script which matches the content within <dd> tag and fetches the content within the corresponding (next) <dt> tag. I wish i could i have been a little more clearer. Any help is greatly appreciated.

    Read the article

  • Error while opening port in Java

    - by Deepak
    I am getting the following error while trying to open the cash drawer. Error loading win32com: java.lang.UnsatisfiedLinkError: C:\Program Files\Java\jdk1.6.0_15\jre\bin\win32com.dll: Can't load IA 32-bit .dll on a AMD 64-bit platform The code i am using is as follows `import javax.comm.; import java.util.; /** Check each port to see if it is open. **/ public class openPort { public static void main (String [] args) { Enumeration port_list = CommPortIdentifier.getPortIdentifiers (); while (port_list.hasMoreElements ()) { // Get the list of ports CommPortIdentifier port_id = (CommPortIdentifier) port_list.nextElement (); // Find each ports type and name if (port_id.getPortType () == CommPortIdentifier.PORT_SERIAL) { System.out.println ("Serial port: " + port_id.getName ()); } else if (port_id.getPortType () == CommPortIdentifier.PORT_PARALLEL) { System.out.println ("Parallel port: " + port_id.getName ()); } else System.out.println ("Other port: " + port_id.getName ()); // Attempt to open it try { CommPort port = port_id.open ("PortListOpen",20); System.out.println (" Opened successfully"); port.close (); } catch (PortInUseException pe) { System.out.println (" Open failed"); String owner_name = port_id.getCurrentOwner (); if (owner_name == null) System.out.println (" Port Owned by unidentified app"); else // The owner name not returned correctly unless it is // a Java program. System.out.println (" " + owner_name); } } } //main } // PortListOpen`

    Read the article

  • jQuery, unable to store data returned by $.get function.

    - by Deepak Prasanna
    I am trying to turn div#sidebar into a sidebar in my app. My code looks like the one below. $('#sidebar').userProfile(); jQuery.fn.userProfile = function() { $.get('/users/profile', function(data){ $(this).html(data); }); }; It didnt work because, I found the this (inside the $.get function) here contexts to the get request and not $('#sidebar'). Then I tried something like below. $('#sidebar').userProfile(); #This doesnot work jQuery.fn.userProfile = function() { var side_bar = null; $.get('/users/profile', function(data){ side_bar = data; }); $(this).html(side_bar); console.log(side_bar); }; This doesnt work either. In firebug console I see Null which I am setting on top when I am declaring the variable.Atlast I made it work by changing my code to something like below by hardcoding the selector. #This works, but I cannot turn any element to a sidebar which is sick. jQuery.fn.userProfile = function() { $.get('/users/profile', function(data){ $('#sidebar').html(data); }); }; But this is not I wanted because I wanted to turn any element to a sidebar. Where am I goin wrong or which is the correct way of doing it?

    Read the article

  • How to call a Thor task multiple times?

    - by deepak
    Thor like Rake (and Make) has task management. If I call a task multiple times, it will effectively call the task only once. How can I call a task multiple times? I tried modifying the @_invocations hash, but that did not work: require 'csv' require './config/environment' class MisReport < Thor desc "all", "generate mysql and postgres mis" def all generate("pg_mis_report", "pg") generate("mysql_mis_report", "mysql") end desc "generate", "generate mis report" def generate(file_name = "mis_report_#{Time.now.to_s(:number)}", connection = "postgres") if connection == "pg" puts "== postgres database" ActiveRecord::Base.establish_connection :development_mysql else puts "== mysql database" ActiveRecord::Base.establish_connection :development end # generate MIS puts puts "mis file is at: #{file_path}" end end

    Read the article

  • Outlook VSTO AddIn Configuration

    - by Deepak N
    I'm working on VSTO addin for outlook 2003.Outlook can read the startup section from Outlook.exe.config. <startup> <supportedRuntime version="v1.0.3705" /> <supportedRuntime version="v1.1.4322" /> <supportedRuntime version="v2.0.50727" /> </startup> But it is not able to read the system.diagnostics section of the config file. Basically i'm trying add trace listeners as i have explained here.Am I missing any thing here.

    Read the article

  • UDP checksum calculation

    - by Deepak Konidena
    Hi, The UDP header struct defined at /usr/include/netinet/udp.h is as follows struct udphdr { u_int16_t source; u_int16_t dest; u_int16_t len; u_int16_t check; }; What value is stored in the check field of the header? How to verify if the checksum is correct? I meant on what data is the checksum computed? (Is it just the udp header or udp header plus the payload that follows it?) Thanks.

    Read the article

  • log analysis for rails

    - by deepak
    i have a rails app which makes heavy use of activeresource and httparty to make api calls. Is there any library/extension to log the requests and parse them, so that log analysis becomes easier and automated. RailsLogAnalyser is good but what about extra calls, what are the conventions? Something like a opensource/self-hosted alternative to newrelic, but with extensions to plug in your own logging.

    Read the article

  • Get the text of an li element

    - by Deepak Prasanna
    <ul class="leftbutton" > <li id="menu-selected">Sample 1</li> <li>Sample 2</li> <li>Sample 3</li> <li>Sample 4</li> <li>Sample 5</li> </ul> I want to get the text of the li item which the id="menu-selected". Right now I am doing something like document.getElementById('menu_selected').childNodes.item(0).nodeValue Is there any simpler way of doing the same?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Issues while downloading document from Sharepoint using JAVA

    - by Deepak Singh Rawat
    I am trying to download a file from Sharepoint 2007 sp2 document library using GetItem method of the Copy webservice. I am facing the following issues : In the local instance ( Windows Vista ) I can save only 10.5 Kb of any file. The webservice is returning only 10.5 Kb of data for any file. On the production server, I am able to List the documents using some credentials but when I am trying to download a document using the same credentials I get a 401 : Unauthorized message. I can download the document using the Sharepoint website successfully.

    Read the article

  • Problem in DLL update in .Net

    - by Deepak
    My site stops working when I drop a new DLL in the bin of my virtual directory. It took to much time to work properly again. Sometimes I have to reset the IIS. Its happening since I upgraded my .Net framework from 1.1 to 3.1

    Read the article

  • Inheritance: when implementing an interface which define a base class property why cant the class im

    - by Deepak
    Lets create some interfaces public interface ITimeEventHandler { string Open(); } public interface IJobTimeEventHandler: ITimeEventHandler { string DeleteJob(); } public interface IActivityTimeEventHandler: ITimeEventHandler { string DeleteActivity(); } public interface ITimeEvent { ITimeEventHandler Handler; } Another Interface public interface IJobTimeEvent :ITimeEvent { int JobID; } Create a class public class JobTimeEvent : IJobTimeEvent { public int JobID = 0; public IJobTimeEventHandler Handler = null; } My question is .. when implementing an interface which define a base class property why cant the class implementing interface return a derived class type object ?? For ex in class JobTimeEvent, IJobtimeEvent needs a property of type ITimeEventHandler but why IJobTimeEventHandler type is not allowed which derived from ITimeEventHandler

    Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >