Search Results

Search found 1126 results on 46 pages for 'rajesh kumar'.

Page 11/46 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • Ruby XMLParsing Exception

    - by Rajesh
    I get a ParseException every time I try to parse a http get_response data in Ruby. The Exception is because of the presence of '&' in the data. How do I solve this? Illegal character '&' in raw string (REXML::ParseException)

    Read the article

  • Get checked Listitems from ListView and pass that to another activity

    - by Rajesh Rajaram
    I'm developing a Androidapplication using ListView. ListView have a one file in each and every ListItem. Here, I have set onItemClickin ListView. So, that if user clicks the ListItememail application gets open and attach the particular file in email. Its for the single File, this gets implemented and working fine. Now I want attach the multiple file in email. i.e. the implementing the CheckBoxin each ListItemand checked items have to attached into the Mail. I know its possible because its very similar to the file manager application that checking the multiple file and deleting the all file by clicking the single Button. But don't know how to do.

    Read the article

  • j2ee deployment error

    - by Rajesh
    hi im new to j2ee.. the problem is while deploying a particular project i'm getting deployment error like "module has not been deployed".. but i'm able to deploy other projects... the error shown is as follows In-place deployment at F:\onlineexam_1\build\web deploy?path=F:\onlineexam_1\build\web&name=onlineexam_1&force=true failed on GlassFish v3 Domain F:\onlineexam_1\nbproject\build-impl.xml:577: The module has not been deployed. BUILD FAILED (total time: 3 seconds) pls assist me to overcome this problem Thnx in advance Raj

    Read the article

  • How to Hide overflow scroller of DIV

    - by Rajesh Rolen- DotNet Developer
    I have set a fix height of DIV and set its overflow-y:scroll but the problem is that if i have got data less than its height event though its showing scroll bar (disabled). please tell me how can i hide it... i mean give me solution so that the scrollbar will only show when data in that DIV is crossing height of DIV.. My code : <div style="overflow-y:scroll; height:290px"> a data grid is here </div>

    Read the article

  • Page Refresh Returns to previous page

    - by Rajesh Rolen- DotNet Developer
    I am using server.transfer to redirect from one to another page... lets say when i click on button1 of page1 i redirects to page2 using server.transfer but than when i refresh that page2 , it get postback and redirects me page1 again.. please tell me where i am doing wrong.? I have tried with both.. but result is same server.Transfer("~/admin/mypage.aspx?msg=A",False ) server.Transfer("~/admin/mypage.aspx?msg=A",True )

    Read the article

  • Why Bluetooth needs DBUS way of communication in android?

    - by Rajesh SO
    I am newbie to Android DBUS, recently I was informed that I need to use DBUS to implement Bluetooth in Android, from DBUS documentation I see DBUS is used for communication medium between two applications. In Android apps -apps communication is through intents, if so why do we need DBUS for Bluetooth ? Is that DBUS serves as communication medium for networking (IP) between two apps since it is built over sockets? Please correct me if my understanding is wrong, any more information on DBUS along with Bluetooth implementation in Android is appreciated. Thanks.

    Read the article

  • How to refresh parent page using javascript / asp.net in mozilla firefox browser

    - by Rajesh Rolen- DotNet Developer
    window.opener.location.reload(); is working fine with IE but not refreshing parent page in mozilla firefox browser.. please tell me how to refresh parent page in cross browser. i have got this function : Shared Sub CloseMyWindow() Dim tmpStr As String = "" tmpStr += "window.open('','_parent','');window.close();" tmpStr += "window.opener.location.reload();" 'Dim currentPage As Page = TryCast(HttpContext.Current.Handler, Page) 'currentPage.ClientScript.RegisterStartupScript(GetType(me), "refresh", tmpStr, True) HttpContext.Current.Response.Write("<script language='javascript'>" + tmpStr + "</script>") HttpContext.Current.Response.End() End Sub

    Read the article

  • How to access Outlook's Scheduler in asp.net

    - by Rajesh Rolen- DotNet Developer
    Please tell me how can i use/integrate/get Outlook's Scheduler in my asp.net application. i mean a person can use Outlook's scheduler to create his schedule..and i can show it in my asp.net application. or if any sample scheduler code/control is available than also give me link of it.. plez help me out.. thanks. i have just read about "Google Data API" and "Calendar Data API" plez tell me about it.. is it can provide me facilities of good scheduler?

    Read the article

  • Show image from clipboard to defalut imageviewer of windows using c#.net

    - by Rajesh Rolen- DotNet Developer
    I am using below function to make a image of current form and set it in clipboard Image bit = new Bitmap(this.Width, this.Height); Graphics gs = Graphics.FromImage(bit); gs.CopyFromScreen(this.Location, new Point(0, 0), bit.Size); Guid guid = System.Guid.NewGuid(); string FileName = guid.ToString(); //Copy that image in the clipbaord. Image imgToCopy = Image.FromFile(Path.Combine(Environment.CurrentDirectory, FileName + ".jpg")); Clipboard.SetImage(imgToCopy); Now my image is in clipboard and i am able to show it in picturebox on other form using below code : mypicturebox.Image = Clipboard.GetImage(); Now the the problem is that i want to show it in default imageviewer of that system. so for that i think using "System.Diagnostics.Process.Start" we can do that.. but i dont know, how to find default imageviewer and how to set clipboard's image in that ... please help me out... if i find solution than thats good otherwise i am thinking to save that file from clipboard to harddisk and then view it in window's default imageviewer... please help me to resolve my problem.. i am using c#.net

    Read the article

  • Please tell me what is error in my date comparison sql query

    - by Rajesh Rolen- DotNet Developer
    Please help me to find out error in my SQL query. I have created this query to compare dates select * from Joinplans jp where cast(convert(varchar,GETDATE(),103) AS datetime) BETWEEN CASE(convert(varchar,jp.planstartDate,103) AS datetime) AND CASE(convert(varchar,DATEADD(DAY,jp.planDays,jp.planstartDate),103) AS DATETIME) It's giving me the error: incorrect near 'AS' I am using SQL Server 2005.

    Read the article

  • how to consume .net webservices

    - by Rajesh Rolen- DotNet Developer
    please tell that can we consume .net web services in php or not. if yes then please tell me how can we do it. i am to create a web service which takes values and save it in database also it will take values and reply some data as a standard xml format. i know how to create web service and how to use it in asp.net but don't know how to use/call it from php. thing is that i will not be writing code in php to consume but wants to know that do i need to take care of any special thing or need to do some extra code to make it available and use by php developers. i am to create web service in .net framework 2.0 Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to load the model ????

    - by rajesh
    How can i load model i have tried several times but do not get the ans my code is <?php class NotesController extends AppController { var $name='Notes'; var $helpers = array('Html','Form','Ajax','Javascript'); var $uses = array('note'); var $components = array('ModelLoader'); function index(){ $this->ModelLoader->setController($this); $result = $this->params['url']['obj']; //print_r($result); $ee=$this->ModelLoader->load('note'); $pass = $this->note->search($result);

    Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >