Search Results

Search found 21349 results on 854 pages for 'thought space designs'.

Page 111/854 | < Previous Page | 107 108 109 110 111 112 113 114 115 116 117 118  | Next Page >

  • Bibtex with no references title

    - by Bryan Ward
    I am working on writing a scientific poster in LaTeX, and I want to include a few references for my work. Because this is a poster, I have my own customized headers for different sections, and don't want my related works to have a separate title. Essentially I have something like this: \begin{textblock}{5.5}(19.5,11) \CHead{Related Work} %a newcommand header I wrote \bibliographystyle{acm} \bibliography{mybib} \end{textblock} And it comes out with a header called "Related Work" like I want, but it also under that says "References", which I don't want. I found a few websites that said that I could override this with something like \renewcommand\refname{} But all this does is take the word "References" out, but the space allotted for the title is still there. Is there a way to completely eliminate the title and any space it may take up?

    Read the article

  • javascript textbox call event when value changes

    - by Senica Gonzalez
    I have a textbox, and whenever the value of the box changes, I want to check and see if 20 digits have been entered. I thought that I would use the onChange event, but this seems to be interpreted as the onBlur event on IE. So then I thought I would use onKeyDown, but the problem comes in if the user wants to paste a value into the field, then the function never gets called. There are no other form boxes so I can't rely on onBlur or expect that they will change focus ever. How do I do this? I just want to evaluate the value of the textbox everytime the value of the textbox changes. <input type="text" onKeyDown="myfunction()">

    Read the article

  • Strange error in SpringMVC Application Startup

    - by Euzel Villanueva
    I'm getting a very strange stack trace when trying to load a SpringMVC application and at a lost to why this is occurring. org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter#0': Cannot create inner bean '(inner bean)' of type [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter] while setting bean property 'messageConverters' with key [4]; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:281) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:125) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveManagedList(BeanDefinitionValueResolver.java:353) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:153) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyPropertyValues(AbstractAutowireCapableBeanFactory.java:1325) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1086) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:442) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:458) at org.springframework.web.servlet.FrameworkServlet.initWebApplicationContext(FrameworkServlet.java:339) at org.springframework.web.servlet.FrameworkServlet.initServletBean(FrameworkServlet.java:306) at org.springframework.web.servlet.HttpServletBean.init(HttpServletBean.java:127) at javax.servlet.GenericServlet.init(GenericServlet.java:160) at org.apache.catalina.core.StandardWrapper.initServlet(StandardWrapper.java:1133) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1087) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:996) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:4834) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5155) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5150) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:965) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBeanInstance(AbstractAutowireCapableBeanFactory.java:911) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:485) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:270) ... 31 more Caused by: org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:141) at org.springframework.beans.factory.support.SimpleInstantiationStrategy.instantiate(SimpleInstantiationStrategy.java:74) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:958) ... 35 more

    Read the article

  • UML Class Relationships

    - by 01010011
    Hi, I would like to confirm whether I am on the right track when identifying common UML class relationships. For example, is the relationship between: 1 a stackoverflow member and his/her stackoverflow user account categorized as a composition relationship or an aggregation relationship? At first I thought it was an association because this member "has a" account. However on second thought, I am thinking its composition because each "part" (user account) belongs to only one whole (user) at a time, meaning for as long as I am logged into stackoverflow, I have to use this one and only account until I log off. If I log back onto stackoverflow with a different account then its composition again. Do you agree? 2 a database and a person's user account an aggregation relationship? I think so because 1 database (the whole) can store 0...* number of user accounts (the parts) but another database can store the same user accounts. Finally, can anyone recommend a website that specializes in designing code using UML? Thanks in advance

    Read the article

  • Sync GIT and ClearCase

    - by Senthil A Kumar
    I am currently working on ClearCase and now migrating to GIT. But we need this migration in a way that all work will be done in GIT and the data will be synced backed to ClearCase stream. We will have the same branch names and stream names in both GIT and CC, so scripting shouldn't be a problem. The problem here is, Can someone suggest which is the best model to sync CC and GIT Have all the Vobs in CC as single repo in GIT, and have the major stream in CC as various branches in GIT. - Single GIT repo (VOBS) and many branches (CC streams). - This takes up less space as VOBs are kept as single repo with many branches. Have important CC branches as independent GIT repositories and each repository having all the CC VOBs. - Many GIT repo for many CC branch - This will take up lots of space as VOBs will be replicated across. Which do you think is the best way to keep it in sync with ClearCase

    Read the article

  • Best Practice: Legitimate Cross-Site Scripting

    - by Ryan
    While cross-site scripting is generally regarded as negative, I've run into several situations where it's necessary. I was recently working within the confines of a very limiting content management system. I needed to include database code within the page, but the hosting server didn't have anything usable available. I set up a couple barebones scripts on my own server, originally thinking that I could use AJAX to import the contents of my scripts directly into the template of the CMS (thus retaining dynamic images, menu items, CSS, etc.). I was wrong. Due to the limitations of XMLHttpRequest objects, it's not possible to grab content from a different domain. So I thought "iFrame" - even though I'm not a fan of frames, I thought that I could create a frame that matched the width and height of the content, so that it would appear native. Again, I was blocked by cross-site scripting "protections." While I could indeed load a remote file into the iFrame, I couldn't execute JavaScript to modify its size on either the host page or inside the loaded page. In this particular scenario, I wasn't able to point a subdomain to my server. I also couldn't create a script on the CMS server that could proxy content from my server, so my last thought was to use a remote JavaScript. A remote JavaScript works. It breaks when the user has JavaScript disabled, which is a downside; but it works. The "problem" I was having with using a remote JavaScript was that I had to use the JS function document.write() to output any content. Any output that isn't JS causes script errors. In addition to using document.write() for every line, you also have to ensure that the content is escaped - or else you end up with more script errors. My solution was as follows: My script received a GET parameter ("page") and then looked for the file ({$page}.php), and read the contents into a variable. However, I had to use awkward buffering techniques in order to actually execute the included scripts (for things like database interaction) then strip the final content of all line break characters ("\n") followed by escaping all required characters. The end result is that my original script (which outputs JavaScript) accesses seemingly "standard" scripts on my server and converts their standard output to JavaScript for displaying within the CMS template. While this solution works, it seems like there may be a better way to accomplish the same thing. What is the best way to make cross-site scripting work specifically for the purpose of including content from a completely different domain?

    Read the article

  • Regex-expression with danish characters

    - by timkl
    I'm currently trying to wrap my head around regex, I have a validation snippet that tests an input box against a regex-expression: $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z]*$/).test(value); }, "Some text"); That works well, but when I try to add a space and some special danish characters, it doesn't filter the danish characters, only the space. $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z æøåÆØÅ]*$/).test(value); }, "Some text"); Any ideas to what could be wrong?

    Read the article

  • Clarification required re use of .NET Assemblies in GAC - Use to use Globally?

    - by Cognize
    Hi, I've done much reading and experimentation today regarding sigining of assemblies, and their installation into the GAC via various methods (mscorcfg.msc / drag and drop). What I thought, was that once a file was in the GAC, you did not need to make references from projects in Visual studio. I know that you CAN make references via the usual Add Reference, Browse etc, but I thought it was automatic. Testing proves this not to be the case. I came across a forum post looking to achieve the same outcome that suggested adding to the machine.config file under system.web as below. This did not work, it in fact broke visual studio until I removed it. <assemblies> <add assembly="Blah.Framework.Logging, Version=1.0.3806.25580, Culture=neutral, PublicKeyToken=0beed4b631ebc3cd" /> </assemblies> What I want to know, is am I right in my assumed use of assemblies in the GAC, and is there a way of making them globally available?

    Read the article

  • Pros and cons of ways of storing an unsigned int without an unsigned int data type

    - by fields
    I have values that are 64-bit unsigned ints, and I need to store them in mongodb, which has no unsigned int type. I see three main possibilities for storing them in other field types, and converting on going in and out: Using a signed int is probably easiest and most space efficient, but has the disadvantage that they're not human readable and if someone forgets to do the conversion, some of them will work, which may obscure errors. Raw binary is probably most difficult for inexperienced programmers to deal with, and also suffers from non-human-readability. A string representation is the least space efficient (~40 bytes in unicode vs 8 bytes per field), but then at least all of the possible values will map properly, and for querying only a conversion to string is required instead of a more complicated conversion. I need these values to be available from different platforms, so a single driver-specific solution isn't an option. Any major pros and cons I've missed? Which one would you use?

    Read the article

  • Python Solitaire

    - by Kevin
    This is more of a thought i had awhile rather than an actual problem to solve, maybe more a discussion, but i was wondering if it would be possible to design the game of solitaire and be abkle to play it in the python GUI or some other form of iterface? I know you can get a deck of cards fairly easily and i know yuo can play simple games like snap and so on but i thought solitaire would be more challenging and fun because there is alot more logic behind it than just laying out the cards randomly. Any ideas? (I would be intrested to hear about or see any solutions if anyone had any links etc..)

    Read the article

  • Doubts in System call mechanism in linux

    - by bala1486
    We transit from ring3 to ring0 using 'int' or the new 'syscall/sysenter' instruction. Does that mean that the page tables and other stuffs that needs to be modified for the kernel is automatically done by the 'int' instruction or the interrupt handler for the 'int 0x80' will do the required stuff and jump to the respective system call. Also when returning from a system call, we again need to go to user space. For this we need to know the instruction address in the user space to continue the user application. Where is that address stored. Does the 'ret' instruction automatically changes the ring from ring3 to ring0 or where/how this ring changing mechanism takes place? Then, i read that changing from ring3 to ring0 is not as costly as changing from ring0 to ring3. Why is this so?? Thanks, Bala

    Read the article

  • ffmpeg screen capture

    - by Mirai
    I wrote this script for some basic screen capture; it gets the window dimensions then uses the ffmpeg binary to record. I suspect there is a better way (maybe with the ffmpeg library), but scripting is what I know and ffmpeg generally works. Any software (other than recordmydesktop), or improvements to the script are welcome. info=`xwininfo -frame` H=`echo "$info" | grep Height | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` W=`echo "$info" | grep Width | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` offset=:0.0+`echo "$info" | grep Corners | sed -E "s/^.*:[[:space:]]+\+([[:digit:]]+\+[[:digit:]]+)[[:space:]]+.+/\1/" | tr + ,` /usr/local/bin/ffmpeg -f x11grab -s ${W}x${H} -r 45 -i $offset -sameq -f avi ~/videos/`date +%Y-%m-%d-%H%M%s`_vid & echo $! > /tmp/$(basename $0)-$USER

    Read the article

  • Enabling full documentation for J2EE in eclipse

    - by maayank
    I'm new to Eclipse and am using it currently to play with J2EE. When using Ctrl+Space for types/functions from the regular Java libraries I get a full description (i.e. general description of the type, what are the arguments of the method for, etc.). However I don't get the same for J2EE types. For example, when using Ctrl+Space on methods of the HttpSession class I get only names like "arg0" or "obj" and no description. Is there some kind of a package I can install to remedy this?

    Read the article

  • Oracle Hash Cluster Overflow Blocks

    - by Andrew
    When inserting a large number of rows into a single table hash cluster in Oracle, it will fill up the block with any values that hash to that hash-value and then start using overflow blocks. These overflow blocks are listed as chained off the main block, but I can not find detailed information on the way in which they are allocated or chained. When an overflow block is allocated for a hash value, is that block exclusively allocated to that hash value, or are the overflow blocks used as a pool and different hash values can then start using the same overflow block. How is the free space of the chain monitored - in that, as data is continued to be inserted, does it have to traverse the entire chain to find out if it has some free space in the current overflow chain, and then if it finds none, it then chooses to allocate a new block?

    Read the article

  • What C#/SQL Server feature did someone show you that made you say Wow!

    - by Randy Minder
    It's late Friday afternoon, and my mind is checking out for the week. So I thought I'd ask a light-hearted, interesting, question. Yesterday a co-worker showed me how he managed to save quite a bit of code and improve code reuse through the use of an anonymous delegate and the use of the Action function. My first thought was, "Wow, I had no idea you could do that!". I'm curious what sort of things someone showed you, either in c# or SQL Server, that made you stop and think, "Wow!". Randy

    Read the article

  • parsing string off a configuration using strtok in C

    - by Jessica
    in the configuration file i have entries similar to this one: filepath = c:\Program Files\some value Where the path can contain spaces and there are no quotes on that string. I tried parsing this with strtok like: char *option; char *value; value = strtok(line, " ="); strcpy(option, value); value = strtok(NULL, " ="); where line is the line I am reading from the file, option will contain the left side of the equal (filepath) and value will contain the right side (c:\program files\some value). I know, it's poor coding, but I haven't found something better. sorry... In any case, for those options where there's no space in the right side it works great, but in those containing spaces it only return the string until the 1st space: c:\Program. Is there any other way to do this? Code is appreciated. Jessica

    Read the article

  • What languages have a while-else type control structure, and how does it work?

    - by Dan
    A long time ago, I thought I saw a proposal to add an else clause to for or while loops in C or C++... or something like that. I don't remember how it was supposed to work -- did the else clause run if the loop exited normally but not via a break statement? Anyway, this is tough to search for, so I thought maybe I could get some CW answers here for various languages. What languages support adding an else clause to something other than an if statement? What is the meaning of that clause? One language per answer please.

    Read the article

  • REG GENERIC METHOD

    - by googler1
    Hi buddies, I had a thought on using the generic method in c# as like we do in c++. Normally a method looks like this: public static (void/int/string) methodname((datatype) partameter) { return ...; } I had a thought whether can we implement the generics to this method like this: public static <T> methodname(<T> partameter) { return ...; } Using as a generic to define the datatype. Can anyone pls suggest whether the above declaration is correct and can be used in c#? Thanks in advance.

    Read the article

  • How to sort in-place using the merge sort algorithm?

    - by eSKay
    I know the question is too open. All I want is someone to tell me how to convert a normal merge sort into an in-place merge sort (or a merge sort with constant extra space overhead). All I can find (on the net) is pages saying "it is too complex" or "out of scope of this text". "The only known ways to merge in-place (without any extra space) are too complex to be reduced to practical program." (from here) Even if it is too complex, can somebody outline the basic concept of how to make the merge sort in-place?

    Read the article

  • Best way to structure AJAX for a Zend Framework application

    - by John Nall
    Sorry, but there's a lot of outdated and just plain bad information for Zend Framework, since it has changed so much over the years and is so flexible. I thought of having an AJAX module service layer, with controllers and actions that interact with my model. Easy, but not very extensible and would violate DRY. If I change the logistics of some process I'll have to edit the AJAX controllers and the normal controllers. So ideally I would load the exact same actions for both javascript and non-javascript users. I have thought about maybe checking for $_POST['ajax'], if it is set I would load a different (json'y) view for the data. Was wondering how/a good way to do this (front controller plugin I imagine?) or if someone can point me to an UP TO DATE tutorial that describes a really good way for building a larger ajax application. thx

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Ajax data two-way data binding strategies?

    - by morgancodes
    I'd like to 1) Draw create form fields and populate them with data from javascript objects 2) Update those backing objects whenever the value of the form field changes Number 1 is easy. I have a few js template systems I've been using that work quite nicely. Number 2 may require a bit of thought. A quick google search on "ajax data binding" turned up a few systems which seem basically one-way. They're designed to update a UI based on backing js objects, but don't seem to address the question of how to update those backing objects when changes are made to the UI. Can anyone recommend any libraries which will do this for me? It's something I can write myself without too much trouble, but if this question has already been thought through, I'd rather not duplicate the work.

    Read the article

< Previous Page | 107 108 109 110 111 112 113 114 115 116 117 118  | Next Page >