Search Results

Search found 6365 results on 255 pages for 'anthony short'.

Page 113/255 | < Previous Page | 109 110 111 112 113 114 115 116 117 118 119 120  | Next Page >

  • Maximum burn speed keeps decreasing from Nero?

    - by Bob King
    I have a 16x DL DVD burner in my work machine (XP SP3). I'm using 8x TDK DVD+R media. The first dozen or so disks burned fine using Nero, but after that I started to coaster every disk. I asked Nero to calculate the maximum speed, and it calculated it at 4x. This worked for a few disks, then the same issues. I'm currently burning at 1.2x. I've since tried other brands and full 16x compatible disks, I can't get my burn speed to be recognized as any faster than what it's currently at. I've tried uninstalling Nero. I've tried burning directly in Windows, and also tested an MP3 CD in iTunes, and no luck. Any suggestions, short of reinstalling Windows, would be great!

    Read the article

  • monitor power and lock screen (Ubuntu Lucid)

    - by xsznix
    Hi, I'm trying to get my screen to turn off whenever I lock my screen. I know that in Power Management, there's an option to turn off the screen after a set amount of time, and I know about xset dpms force off, but the former doesn't allow me to turn off the screen from the logout menu, and the latter only turns the screen off for a short amount of time (1 minute or so. The screen just turns back on by itself). Is there a script I can modify to change what happens when "Lock screen" from the logout menu is selected, or is there a script I can add to the panel to lock the screen and then turn the monitor off (and turning it back on when I shake the mouse or something)? Thanks.

    Read the article

  • Redirect traffic to local address so iOS speedtest app measures LAN speed

    - by ivan_sig
    I have mounted a Speedtest Mini server on a local LAMP, so I can test my LAN speeds effortlessly just by opening the URL with a Flash enabled web browser, the thing is, I want my iOS and Android devices to test with the LAN server too, not with the WAN, as I'm trying to measure LAN-Only performance. Is there a way so I can redirect the traffic intended to an specific external IP (The one of the real server) to my local server?. I know the servers IP as a short Wireshark analysis gave me the data, but still searching for a way to make that redirect. I have Jailbreak and root on my devices, so playing with system files is not a problem. I've tried mounting a proxy and making redirects by the hosts file and domain names, but it looks like Ookla's app relies on IP address only.

    Read the article

  • TrueCrypt - "Warning! Password locked: Fixed disk0" error message on boot

    - by Tibi
    TrueCrypt - "Warning! Password locked: Fixed disk0" error message on boot. When i start my laptop (Acer TravelMate 2410). after the starting memory check, the screen goes full black, and a message appears for about 3 seconds: Warning! Password locked: Fixed disk0 and after that, disappears, and next message comes out: Operating System Not Found and all stops here. Windows Xp was installed on it, before this came. TrueCrypt cd (witch was made during the process of full encryption) is not working, not in restoring MBR, no even in decrypting my drive - completely useless. Note: I detected some short of boot sector errors (i dont know the amount) on my drive before this happened. Please, i would greatfully thank every comment, or suggestion, because my computer is unusable now. The HDD is a Samsung HDD, 160Gb. Other preferences: Acer TravelMate 2410 Notebook, 2 Gb RAM, 1500 Mhz Intel Celeron M processor. Regards

    Read the article

  • Apache web server: "proxying" a webapp from another server?

    - by Riddler
    Sorry for the lame terminology - I'm no way a sysadmin... So here's the deal. I have two Linux boxes in the same network, let's refer to those boxes by their IPs, a.b.c.d and e.f.g.h. Each box runs some webapp, normally available like http://a.b.c.d/ and http://e.f.g.h/. What I want to accomplish is this: with some Apache web server (which by the way lives on both boxes) configuration voodoo, the first app would be available via http://a.b.c.d/whatever1/, and the 2nd app would be available as http://a.b.c.d/whatever2/ - but would still reside on another server (e.f.g.h). Long story short - is it at all possible to do this with Apache configuration magic and without touching the webapps and their configuration? If so - how? :) Thanks in advance!

    Read the article

  • Super simple high performance http server

    - by masylum
    I´m building a url shortener web application and I would like to know the best architecture to do it in order to provide a fast and reliable service. I would like to have two separate servicies in different machines. The first machine will have the application itself with a apache, nginx, whatever.. The second one will contain the database. The third one will be the one that will be responsible to handle the short url petitions. For the third machine I just need to accept one kind of http petition (GET www.domain.com/shorturl), but it have to do it really fast and it should be stable enough. Which server do you recommend me? Thank's in advance and sorry for my english

    Read the article

  • Will installing an Ultra ATA cable backwards affect performance?

    - by GMMan
    I've recently purchased a hard drive upgrade for my Xbox 320GB WD Caviar Blue WD3200AAJB and StarTech.com Ultra ATA/66/100/133 cable IDE66 yes I'm crazy When it came to installing the cable, it was too short (my fault), and there wasn't enough space between the master and slave ends to reach both the DVD drive and the hard drive. The only thing I could do was install the cable backwards and twisting it quite a bit to make it fit. The upgrade works, but reading the manual for the hard drive I replaced (10GB Seagate U Series 5), apparently there is a specific way you have to connect the cable. I don't have that option, so the question comes down to, will my drive performance be at Ultra ATA levels, or is it still performing at original ATA speeds? Is there any way I can test this (benchmarking software for Xbox)?

    Read the article

  • Finding (listing) all Youtube videos embedded under a single domain?

    - by Tylerr
    Is there a way (a google search, maybe?) to list/find all Youtube videos embedded under a single domain? There used to be (if memory servers) an option on youtube, to find all videos from a single site (they were referencing them as "blogs"), but was available for short period of time and it totally disappeared. I was experimenting with a couple google searches, but to no avail, like this one: site:theverge.com intext:"youtube.com/embed" Even if it worked, it wouldn't provide elegant "thumbnailed" results. Anyone has any ideas? Thanks

    Read the article

  • How do i route TCP connections via TOR? [on hold]

    - by acidzombie24
    I was reading about torchat which is essentially an anonymous chat program. It sounded cool so i wanted to experiment with making my own. First i wrote a test to grab a webpage using Http. Sicne .NET doesnt support SOCKS4A/SOCKS5 i used privoxy and my app worked. Then i switch to a TCP echo test and privoxy doesnt support TCP so i searched and installed 6+ proxy apps (freecap, socat, freeproxy, delegate are the ones i can remember from the top of my head, i also played with putty bc i know it supports tunnels and SOCK5) but i couldnt successfully get any of them to work let alone get it running with my http test that privoxy easily and painlessly did. What may i use to get TCP connections going through TOR? I spent more then 2 hours without success. I don't know if i am looking for a relay, tunnel, forwarder, proxy or a proxychain which all came up in my search. I use the config below for .NET. I need TCP working but i am first testing with http since i know i had it working using privoxy. What apps and configs do i use to get TCP going through tor? <?xml version="1.0" encoding="utf-8" ?> <configuration> <system.net> <defaultProxy enabled="true"> <proxy bypassonlocal="True" proxyaddress="http://127.0.0.1:8118"/> </defaultProxy> <settings> <httpWebRequest useUnsafeHeaderParsing="true"/> </settings> </system.net> </configuration> -edit- Thanks to Bernd i have a solution. Here is the code i ended up writing. It isn't amazing but its fair. static NetworkStream ConnectSocksProxy(string proxyDomain, short proxyPort, string host, short hostPort, TcpClient tc) { tc.Connect(proxyDomain, proxyPort); if (System.Text.RegularExpressions.Regex.IsMatch(host, @"[\:/\\]")) throw new Exception("Invalid Host name. Use FQDN such as www.google.com. Do not have http, a port or / in it"); NetworkStream ns = tc.GetStream(); var HostNameBuf = new ASCIIEncoding().GetBytes(host); var HostPortBuf = BitConverter.GetBytes(IPAddress.HostToNetworkOrder(hostPort)); if (true) //5 { var bufout = new byte[128]; var buflen = 0; ns.Write(new byte[] { 5, 1, 0 }, 0, 3); buflen = ns.Read(bufout, 0, bufout.Length); if (buflen != 2 || bufout[0] != 5 || bufout[1] != 0) throw new Exception(); var buf = new byte[] { 5, 1, 0, 3, (byte)HostNameBuf.Length }; var mem = new MemoryStream(); mem.Write(buf, 0, buf.Length); mem.Write(HostNameBuf, 0, HostNameBuf.Length); mem.Write(new byte[] { HostPortBuf[0], HostPortBuf[1] }, 0, 2); var memarr = mem.ToArray(); ns.Write(memarr, 0, memarr.Length); buflen = ns.Read(bufout, 0, bufout.Length); if (bufout[0] != 5 || bufout[1] != 0) throw new Exception(); } else //4a { var bufout = new byte[128]; var buflen = 0; var mem = new MemoryStream(); mem.WriteByte(4); mem.WriteByte(1); mem.Write(HostPortBuf, 0, 2); mem.Write(BitConverter.GetBytes(IPAddress.HostToNetworkOrder(1)), 0, 4); mem.WriteByte(0); mem.Write(HostNameBuf, 0, HostNameBuf.Length); mem.WriteByte(0); var memarr = mem.ToArray(); ns.Write(memarr, 0, memarr.Length); buflen = ns.Read(bufout, 0, bufout.Length); if (buflen != 8 || bufout[0] != 0 || bufout[1] != 90) throw new Exception(); } return ns; } Usage using (TcpClient client = new TcpClient()) using (var ns = ConnectSocksProxy("127.0.0.1", 9050, "website.com", 80, client)) {...}

    Read the article

  • Run totally silent rsync?

    - by jackr
    I have a cronjob that runs hourly, and is totally silent unless something goes wrong. Well ... almost ... A part of the job is rsync --del -Cacqrz public/. [email protected]:/target/path This always prints "logged in". How can I make it stop? (Short of 'grep -v' ;-) I don't get the "logged in" message if I do things like ssh [email protected] ls The transport is, of course, ssh (using keys). Source host is either OSX or Ubuntu (tried both, same behavior). Target host is Linux of some flavor.

    Read the article

  • Constantly visible notification and access icon for Empathy in Gnome 3

    - by aef
    Since a short while I'm using Ubuntu Oneiric Ocelot (11.10) with gnome-shell (Gnome 3) and I'm trying to get accustomed to the default Empathy Instant Messaging client. One mayor problem for me (coming from Gnome 2 and Psi) is that there is no constantly visible icon which makes it clear (for example by changing its icon or showing an animation) if there are incoming messages which I did not read already and which lets me jump into them with one click. Also I'm missing a way to bring up the contact list or hide it away with a click. I sometimes have real problems even figuring out how to even open the contact list up again. Is there a Gnome 3 extension or some other trick available to display such a notifier in the top bar? I'm talking about something just like the sound and network controls which are already located there. I know that there are notifications in the lower notification area (former system tray), but as it is only visible as I move the mouse in the lower right corner of the screen, its useless for me.

    Read the article

  • Re-cased my computer now the power plug keeps shorting

    - by dunc
    I've just re-cased my computer. I got the new case free and thought I'd be able to swap everything over myself but apparently I've done something wrong. I'm OK with components generally but wasn't totally confident about doing this. So, my question is, when setting up a new PC or moving old components into a new case, what could I have done which causes the power cable plug to short/fuse when I plug it in?. Is this likely to be an issue with the cables from my PSU, or could it be the internal case connectors? What steps would you take to diagnose the problem? I'd rather not start again if I don't have to...! Thanks in advance,

    Read the article

  • Shortcut for enabling / disabling Greasemonkey (or specific script)

    - by ldigas
    talking about firefox here ... I don't use Greasemonkey on any other browser, but if you know, do add info for those as well I use Greasemonkey daily ... having some 20 scripts loaded all the time which save me a ton of grief. But, some of them I sometimes don't need ... few examples: - I use Google Image Status Reporter & Direct Images (links you directly to image file) ... but sometimes I want to go to the page where the image is ... - GReader Minimalist Style ... until I actually need to check the trends and some stuff it hides - there are other examples but these two first sprang to mind, since I just were thinking about that ... To put the long story short ... sometimes I would like a shortcut to disable Greasemonkey, so I don't have to go into the menubar and so on (which I also have half hidden for space) ... anyone knows of any, or how one could create one ?

    Read the article

  • Right-aligning button in a grid with possibly no content - stretch grid to always fill the page

    - by Peter Perhác
    Hello people, I am losing my patience with this. I am working on a Windows Phone 7 application and I can't figure out what layout manager to use to achieve the following: Basically, when I use a Grid as the layout root, I can't make the grid to stretch to the size of the phone application page. When the main content area is full, all is well and the button sits where I want it to sit. However, in case the page content is very short, the grid is only as wide as to accommodate its content and then the button (which I am desperate to keep near the right edge of the screen) moves away from the right edge. If I replace the grid and use a vertically oriented stack panel for the layout root, the button sits where I want it but then the content area is capable of growing beyond the bottom edge. So, when I place a listbox full of items into the main content area, it doesn't adjust its height to be completely in view, but the majority of items in that listbox are just rendered below the bottom edge of the display area. I have tried using a third-party DockPanel layout manager and then docked the button in it's top section and set the button's HorizontalAlignment="Right" but the result was the same as with the grid, it also shrinks in size when there isn't enough content in the content area (or when title is short). How do I do this then? ==EDIT== I tried WPCoder's XAML, only I replaced the dummy text box with what I would have in a real page (stackpanel) and placed a listbox into the ContentPanel grid. I noticed that what I had before and what WPCoder is suggesting is very similar. Here's my current XAML and the page still doesn't grow to fit the width of the page and I get identical results to what I had before: <phone:PhoneApplicationPage x:Name="categoriesPage" x:Class="CatalogueBrowser.CategoriesPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:phone="clr-namespace:Microsoft.Phone.Controls;assembly=Microsoft.Phone" xmlns:shell="clr-namespace:Microsoft.Phone.Shell;assembly=Microsoft.Phone" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" FontFamily="{StaticResource PhoneFontFamilyNormal}" FontSize="{StaticResource PhoneFontSizeNormal}" Foreground="{StaticResource PhoneForegroundBrush}" SupportedOrientations="PortraitOrLandscape" Orientation="Portrait" mc:Ignorable="d" d:DesignWidth="480" d:DesignHeight="768" xmlns:ctrls="clr-namespace:Microsoft.Phone.Controls;assembly=Microsoft.Phone.Controls.Toolkit" shell:SystemTray.IsVisible="True"> <Grid x:Name="LayoutRoot" Background="Transparent"> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition Height="*"/> </Grid.RowDefinitions> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition Width="*" /> <ColumnDefinition Width="Auto" /> </Grid.ColumnDefinitions> <StackPanel Orientation="Horizontal" VerticalAlignment="Center" > <TextBlock Text="Browsing:" Margin="10,10" Style="{StaticResource PhoneTextTitle3Style}" /> <TextBlock x:Name="ListTitle" Text="{Binding DisplayName}" Margin="0,10" Style="{StaticResource PhoneTextTitle3Style}" /> </StackPanel> <Button Grid.Column="1" x:Name="btnRefineSearch" Content="Refine Search" Style="{StaticResource buttonBarStyle}" FontSize="14" /> </Grid> <Grid x:Name="ContentPanel" Grid.Row="1"> <ListBox x:Name="CategoryList" ItemsSource="{Binding Categories}" Style="{StaticResource CatalogueList}" SelectionChanged="CategoryList_SelectionChanged"/> </Grid> </Grid> </phone:PhoneApplicationPage> This is what the page with the above XAML markup looks like in the emulator:

    Read the article

  • Cutting up videos (excerpting) on Mac OS X -- iMovie produces super-large files

    - by markvgti
    I need to cut out parts of a video (+ the associated audio, of course) to make a short clip. For example, take 2 minutes from one location, 3 minutes from another part of the video, 30 seconds from another location and join it all together to form one single clip. The format of the input video is mp4 (H.264 encoding, AFAICR). Don't need very sophisticated merges or transitions from one part to the next, or sophisticated banners (text) on-screen, but some ability to do so would be a plus point. I've done this with iMovie in the past, but where the original file was under 5MB/min of play time, the chopped-up version was over 11MB/min of play time, which to me seems really bad. Is there a better/different way of doing this on OS X? Looking for free (gratis) solutions. OS: OS X 10.9.3

    Read the article

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • Lots of artifacts while streaming HD content with VLC 0.9.9 on CentOS

    - by Zsub
    I'm trying to stream (multicast) a x264 encoded file using VLC. This in itself succeeds, but the stream has a huge lot of artifacts. This seems to suggest that the data cannot be transported fast enough. If I check network usage, though, it's only using about 15 mbit. I have a similar SD stream which functions perfectly. I think I could improve stream performance by not streaming the raw data, but I cannot seem to get this working. It seems that on keyframes all artifacts are removed for a short while (less than a second). This is the command I use: vlc -vv hdtest.mkv --sout '#duplicate{dst=rtp{dst=ff02::1%eth1,mux=ts,port=5678,sap,group="Testgroup",name="TeststreamHD"}}' --loop Which is all one long line.

    Read the article

  • Optimize Windows file access over network

    - by Djizeus
    At my company I frequently need to access shared files over a Windows network. These files are located on the other side of the planet, so I guess the file share goes through some kind of VPN over Internet, but I don't control this and it is supposed to be "transparent" for me. However it is extremely slow. Displaying the content of a directory in the file explorer takes about 10s. Even if over the Internet, I did not expect that retrieving a list of file names would be that long. Are there any settings to optimize this from my Windows XP workstation, or is it mostly related to the way the network is configured? The only thing I have found so far is to cache all file names, while by default only short file names are cached (http://support.microsoft.com/kb/843418).

    Read the article

  • Link two or more text boxes in Visio

    - by Dan
    I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

    Read the article

  • Computer freezes, wireless network icon disappears

    - by Heidi
    As you can see I have two problems. I have a Toshiba Tecra A3 computer. It is 5-6 years old and it is connected to a D-link router. For a period now it has not been working correctly. The computer freezes either when i try turning it on or when I have been using the computer for a short period of time. The times the computer works normally I have a problem with a disappearing wireless network icon, and so I have no internet. Can this be fixed or do I have to buy a new computer? I only use the computer for internet surfing and easy tasks like word etc, so I would like to keep it as long as possible.

    Read the article

  • not able to make entry of ubuntu 10.04 grub.cfg into redhat 5.1 menu.lst file to run 2 linux os and

    - by Deepak Narwal
    Hello friend... In my computer there are three operating systems.. First i installed Windows 7 then i installed ubuntu 10.04 and in last i installed redhat 5.1 NOw i know one thing as i installed redhat then grub installed by ubuntu will be overwritten by redhat grub..and i know that to see all three operating syetm at the startup i have to make entry of /boot/grub/cfg into /boot/grub/menu.lst file.. Now the problem is like this In te previous version it was very easy to play with ubuntu grub file but now this file is modified..NOw i dont know what is to be picked up from ubuntu /grub/grub.cfg file so that i can make entry in redhat /boot/grub/menu.lst file.. In short i am not able to put entry of grub.cfg file into redhat menu.lst file.. will u help me plz i want to work on these thre eOS..

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Upgrade Subversion 1.6 to 1.7 on CentOS? (can't find yum repository)

    - by user743919
    I want to upgrade my SVN Server from 1.6 to 1.7. Unfortunately I can't find anything on the internet how to do this with yum. I have checked rpmforge-extras but it has only svn 1.6 and not 1.7 I wanted to update with yum because this is the most secure way for me. I'm not an experienced Linux user. Is there a yum repository that contains 1.7 (subversion.x86_64 0:1.7.xxxxx.el5.rfx) I hope somebody can help me out? If there is non, perhaps a short explenation how to update with just step by step.

    Read the article

  • Bringing my Dell XPS 13 ultrabook back to factory state

    - by TysHTTP
    I have a brand new Dell XPS 13 ultra book. After i picked it up at the store, i wiped the exising partitions which also contained the restore/rescue data, which you need to reinstall the factory version of Windows 8 that comes with this machine. I did this because we have a different MS partner edition of Windows which i prefer to run. After doing all this, i noticed that there was something wrong with machine. No real damage, but the specs are not completely as they should be. Turned out that a simple mistake while ordering. Now, long story short, the shop says that it has no problem with taking the product back, as long as it is in it's original state. And this is the problem i'm having, because i formatted the original partitions that contain that rescue option / windows 8 setup, i don't have a clue whether it's possible to get back to that original. Does anyone have an idea on how to get this fixed?

    Read the article

  • WD Elements Desktop External - Not recognised on a single computer

    - by Aelexe
    My WD Elements Desktop External is no longer recognised on my main computer. It has worked fine in the past, but now all of a sudden is not detected. It does not prompt when plugged in, nor does it show up in the disc management interface or the device manager. It appears to be aware that it is plugged in however as the light on the external blinks rapidly for a short while after being plugged in. The strangest thing however is that it works fine on other computers, including my family computers and my laptop. I have attempted to troubleshoot the issue by trying various USB devices in multiple ports on each system to see if there is any correlation with the issue, but have come up with nothing that gives me an idea of what is going on. I have also attempted to format the external using my laptop, but that has not helped either. If anyone has had a similar issue, or knows of any potential solutions, please post your advice. Thanks for your time.

    Read the article

< Previous Page | 109 110 111 112 113 114 115 116 117 118 119 120  | Next Page >