Search Results

Search found 44691 results on 1788 pages for 'first'.

Page 113/1788 | < Previous Page | 109 110 111 112 113 114 115 116 117 118 119 120  | Next Page >

  • Excel Matching problem with logic expression

    - by abelenky
    I have a block of data that represents the steps in a process and the possible errors: ProcessStep Status FeesPaid OK FormRecvd OK RoleAssigned OK CheckedIn Not Checked In. ReadyToStart Not Ready for Start I want to find the first Status that is not "OK". I have attempted this: =Match("<>""OK""", StatusRange, 0) which is supposed to return the index of the first element in the range that is NOT-EQUAL (<) to "OK" But this doesn't work, instead returning #N/A. I expect it to return 4 (index #4, in a 1-based index, representing that CheckedIn is the first non-OK element) Any ideas how to do this?

    Read the article

  • Cant install windows 7(boot problem)

    - by Vadiklk
    First of all, I cant boot my windows 7. I get a black screen with a cursor up in the left corner. So, I tried using windows 7 installation which I've put on my flash drive. To boot from the drive, I've changed the boot order to boot from the drive first. It boots but does not find any HDD to install the windows on(which is pretty logic, I dont boot the HDD soon enough for the installer). but if i put the HDD in front of the flash drive in the boot order, it will just try to load windows 7 and i will get the black screen again. I've tried putting the HDD first and clicking f8 a lot. All I've got is an error. Something about some software change. I dunno. Help me please, cant do anything with my laptop till then.

    Read the article

  • Reshape linux md raid5 that is already being reshaped?

    - by smammy
    I just converted my RAID1 array to a RAID5 array and added a third disk to it. I'd like to add a fourth disk without waiting fourteen hours for the first reshape to complete. I just did this: mdadm /dev/md0 --add /dev/sdf1 mdadm --grow /dev/md0 --raid-devices=3 --backup-file=/root/md0_n3.bak The entry in /proc/mdstat looks like this: md0 : active raid5 sdf1[2] sda1[0] sdb1[1] 976759936 blocks super 0.91 level 5, 64k chunk, algorithm 2 [3/3] [UUU] [>....................] reshape = 1.8% (18162944/976759936) finish=834.3min speed=19132K/sec Now I'd like to do this: mdadm /dev/md0 --add /dev/sdd1 mdadm --grow /dev/md0 --raid-devices=4 --backup-file=/root/md8_n4.bak Is this safe, or do I have to wait for the first reshape operation to complete? P.S.: I know I should have added both disks first, and then reshaped from 2 to 4 devices, but it's a little late for that.

    Read the article

  • Connecting switch to switch to router

    - by elated
    Hello, Not sure if this is the right place to ask this question. But I have a router which connects to the internet. Now I have a switch connected to this router. I added a lot more computers so I added another switch and connected it to the first switch using a cross-over cable. As soon as I connect it to the first switch, my lights in first switch start blinking like crazy and my entire network simply stops working. The minute I remove the second switch's wire, its all fine again. What could be the problem?

    Read the article

  • Labels mail merge repeats on subsequent pages?

    - by leeand00
    I'm trying to do a mail merge to print to labels. The first field in the document does not contain a { NEXT } field code, and because of this the records repeat between label pages for example: Notice how the records shift to the left as the next page is displayed? But how they start over again in an off by one manner? Now I've tried to fix this by using the first record displayed on a page to see if the page number is 1. If it not on page 1 of the mail merge then it should just move to the next record; otherwise it should just display the first record: This doesn't work however, because when I do the preview and display the {page} field code, it reports that I am always on page 1 and thus the same behavior continues instead of just moving to the next record on the next page.

    Read the article

  • Laptop power supplies, does current matter?

    - by CodeSlave
    I have two laptops (same manufacture), with the same type of power connector. However, the power supplies/transformers are slightly different. The output on the first laptop's power supply is 15.6 V at 8.0 A. The output on the second laptop's power supply is 15.6 V at 5A. Clearly the voltages are the same, but the currents are different. I assume the second laptop's power supply can not be used on the first, because it can't supply enough power to the laptop. However, can the first laptop's power supply be safely used on the second laptop?

    Read the article

  • Flow of packets in network

    - by user58859
    I can't visualize in my mind the network traffic flow. eg. If there are 15 pc's in a LAN When packet goes from router to local LAN, do it passes all the computers? Does it go to the ethernet card of every computer and those computers accept the packet based on their physical address? To which pc the packet will go first? To the nearest to the router? What happens if that first pc captures that packet(though it is not for it)? What happens when a pc broadcast a message? Do it have to generate 14 packets for all the pc's or only one packet reach to all pc's? If it is one packet and captured by first pc, how other pc's can get that? I can't imagine how this traffic is exactly flows? May be my analogy is completely wrong. Can anybody explain me this?

    Read the article

  • Multi-Document TOC showing in wrong order

    - by Jeremy DeStefano
    I had a large document that was having formatting issues, so I split it into 2 files. Chapters 1-7 are in the main doc with the TOC and a second doc has chapters 8-12. I have the following: {TOC \O "1-3" \H \Z \U} {RD \f "MCDPS Training Manual Part2.docx"} The TOC is created and has entries from both documents, however its showing the entries from Chapter 8-11 first and then Chapter 1-7. I've read that it should list them based on page numbers, but its not. Chapter 8 starts at page 121, yet its listing it first. How can I get it to show the TOC from the main doc first and then the RD?

    Read the article

  • SMTP Server Issue in intersystem cache

    - by nayanak
    I am facing an issue when I am sending Email from intersystems cache. I am able to send the mail, with out any problem the first time. But the second time when I am trying to send the smtp server is not responding properly. The first Helo command is sent. I recieve the confirmation 220 from the server. But I do not recieve the Message 250. So the next command is giving me the error 503, 5.5.2 "Send helo first" message. I am unable to find out why the server is not responding the second time.

    Read the article

  • Word: MAC 2011, TOC on too many pages

    - by Mark
    I have a Word: MAC 2011 document where the bottom of the first 40 pages or so say "TOC: Page x". This notation appears to be in the Footer, as it is gray until I click on it (then the rest of the text goes gray instead). There is no TOC that I can see in the document, so I'm presuming someone tried to create one and messed things up. After the first 40 pages or so, all the other bottom of the page notations appear to be correct. (i.e. Chapter One, Chapter Two, etc.) How can I get those first 40 pages to be part of Chapter One rather than TOC?

    Read the article

  • Why does Windows Explorer highlight only second entry?

    - by normanius
    Why does Windows Explorer highlight the second but never the first entry if I use the keyboard for navigation? Example: let's look at a folder that contains the following entries a1 a2 a3 b1 b2 If I hit 'a' on the keyboard, the explorer highlights entry 'a2' instead of 'a1'. It works fine for 'b' with 'b1' (because it's not the first entry). Similarly, if I open a folder and use the arrow-down key to navigate then the first entry is skipped again. Why?! It's probable that I'm too stupid for this but this "feature" really annoys me!

    Read the article

  • Does Win 7 still requires copying all files over before burning to a DVD-R or BD-R?

    - by Jian Lin
    It seems that Win 7 still needs to copy all files over to a folder, before it burns all files to the DVD-R or BD-R? I think since XP or Vista, Windows always copy everything over to a temporary folder before it will burn to an empty DVD-R. So if you just want to burn a 4GB file to an empty DVD-R, it will first make a copy of that file, and then burn it, instead of just burning it without making a copy first. And now on Win 7, it seems like it is the case also? Most other 3rd party burning tools won't make an extra copy of the files first... Win 7 is the exception. Is there a way around it? (to avoid copying over 25GB or 50GB of data before burning)

    Read the article

  • How Do I Enable CUPS Browsing Across A Network?

    - by David Mackintosh
    I have a CUPS server with two print queues defined. Once this was defined, all the CUPS clients on the same subnet could see the two print queues automatically, no problem. Now I have a collection of machines on a separate subnet, reachable from the first subnet by a router. How do I enable CUPS browsing on the second set of machines so that they can see the print queues defined on the first machine? Let's call the server A.B.C.7. The first subnet is A.B.C.0/24. The second subnet is A.B.D.0/24, and there is a router with arms on both networks.

    Read the article

  • Pre-load MS Windows right-click menus and Start menu at startup

    - by Steve
    Hello brainy people. On my WinXP SP3 laptop (1.4Ghz 1.2GB ram), after I first log in, when I right-click in Windows Explorer and choose New, the submenu can take up to 15 seconds to load, which is a pain in the ass when you want to do a quick easy operation. After the submenu has loaded the first time, subsequent loads perform instantly, obviously as the menu has been cached. My question is: can these right-click menus (and the Start menu, which also takes some time to load the first time) be pre-loaded at Windows startup? Thanks.

    Read the article

  • Excel Matching problem with logic expression

    - by abelenky
    I have a block of data that represents the steps in a process and the possible errors: ProcessStep Status FeesPaid OK FormRecvd OK RoleAssigned OK CheckedIn Not Checked In. ReadyToStart Not Ready for Start I want to find the first Status that is not "OK". I have attempted this: =Match("<>""OK""", StatusRange, 0) which is supposed to return the index of the first element in the range that is NOT-EQUAL (<) to "OK" But this doesn't work, instead returning #N/A. I expect it to return 4 (index #4, in a 1-based index, representing that CheckedIn is the first non-OK element) Any ideas how to do this?

    Read the article

  • Is there a reason the partition tool GParted doesn't show a percentage finish number initially?

    - by Jian Lin
    I am using GParted more, and it seems to do a reliable work. I just wonder why if the tasks is to resize a 250GB partition to 190GB, and then create a new partition, the first 10, 15 minutes, there is only a blue bar moving left and right, but there won't be an indicator showing how many percent is done. Then after that 10 to 15 minutes, it does show 1:05:00 left to finish the job. Update: at first I thought there is no percentage or time remaining at all... but after waiting for 10, 15 mintues, it does show. I just wonder why it didn't show at first.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Boot from Second SATA Drive

    - by Chris
    I have a Dell Precision 490 Workstation, and I just had my other question answered, Install Ubuntu to drive B without impacting drive A, and now I'm having a boot sequence issue. The external drive is great, boots up fine on my laptop, but how do I tell my desktop to boot from my second SATA drive and not the first SATAdrive. My drive configuration as follows SATA-0: Windows SATA-1: DVDR SATA-2: Ubuntu When I choose the boot menu, the option I have is "Internal Hard Drive". I assume it searches all drives, and loads the first bootable one it finds (which happens to be Windows), but I'd like to be able to select the drive from a list. Has anyone experienced this? Is possible without disabling the first hard drive in the BIOS?

    Read the article

  • ESX Firewall Command Troubles

    - by John
    Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

    Read the article

  • Sudo asks for password twice with LDAP authentication

    - by Gnudiff
    I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

    Read the article

  • How to convert excel individual cell values to percentage change values over time

    - by cgalloway
    I have two years of excel data showing daily share prices of a particular stock. I want to change those values to show percentage change (on a daily basis) from the zero date (ie the first day of the two year period). I know that the formula for showing daily percentage change would be (second day/first day -1) and that I can click and drag on that formula to extend over the rest of the two-year time period. The formula I want would be, basically, (each day/first day-1). Is there an easy way to automate the script so I dont have to type it out 730 times?

    Read the article

  • Merged rows in column, bottom row fixed height

    - by Styxxy
    I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

    Read the article

  • Asterisk Register username with special character like "@"

    - by Najibul Huq
    I am using a SIP provider that has provided me with a username like: [email protected] (Note this is only the username part) And has a numerical password. My Register string looks something like this: [email protected]:[email protected] But this is not working, as asterisk is only sending the first part +112223344 before the first @. My provider is adamant about having the full form of it. This is the first time I am facing this issue that is quite unusual for me. Please help.

    Read the article

  • Ubuntu 12.04 on Amazon EC2: /dev/xvda1 will be checked for errors at next reboot?

    - by cwd
    I'm running the lastest Ubuntu 12.04 AMI (ami-a29943cb) from Canonical on Amazon EC2 and quite often when I log in I get the message: *** /dev/xvda1 will be checked for errors at next reboot *** I have read a bunch of documentation on this and seem to understand that every so many reboots (around 37 see Mount count / Maximum mount count below) Ubuntu wants to check a disk for errors. I can see that by using dumpe2fs -h /dev/xvda1 (reference) to get information such as: Last mounted on: / Filesystem UUID: 1ad27d06-4ecf-493d-bb19-4710c3caf924 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype needs_recovery extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: (none) Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 524288 Block count: 2097152 Reserved block count: 104857 Free blocks: 1778055 Free inodes: 482659 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 511 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 Flex block group size: 16 Filesystem created: Tue Apr 24 03:07:48 2012 Last mount time: Thu Nov 8 03:17:58 2012 Last write time: Tue Apr 24 03:08:52 2012 Mount count: 3 Maximum mount count: 37 Last checked: Tue Apr 24 03:07:48 2012 Check interval: 15552000 (6 months) Next check after: Sun Oct 21 03:07:48 2012 Lifetime writes: 2454 MB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: 0a25e04c-6169-4d68-bfa6-a1acd8e39632 Journal backup: inode blocks Journal features: journal_incompat_revoke Journal size: 128M Journal length: 32768 Journal sequence: 0x0000158b Journal start: 1 I've tried these things to get rid of the message and usually the badblocks is what does it for me: Run this command and reboot: sudo touch /forcefsck Run badblocks to check the disk: badblocks /dev/sda1 Edit /etc/fstab and change the last "0" which is the fs_passno column accordingly and then reboot: The root filesystem should be specified with a fs_passno of 1, and other filesystems should have a fs_passno of 2. I don't understand: If this is a virtual drive shouldn't it be less prone to errors? Was the image created with one of the flags set? If not what is triggering it? Why is fs_passno set to 0 on Amazon EC2 Ubuntu images? This is not the first one that is like this.

    Read the article

  • Sublinear Extra Space MergeSort

    - by hulkmeister
    I am reviewing basic algorithms from a book called Algorithms by Robert Sedgewick, and I came across a problem in MergeSort that I am, sad to say, having difficulty solving. The problem is below: Sublinear Extra Space. Develop a merge implementation that reduces that extra space requirement to max(M, N/M), based on the following idea: Divide the array into N/M blocks of size M (for simplicity in this description, assume that N is a multiple of M). Then, (i) considering the blocks as items with their first key as the sort key, sort them using selection sort; and (ii) run through the array merging the first block with the second, then the second block with the third, and so forth. The problem I have with the problem is that based on the idea Sedgewick recommends, the following set of arrays will not be sorted: {0, 10, 12}, {3, 9, 11}, {5, 8, 13}. The algorithm I use is the following: Divide the full array into subarrays of size M. Run Selection Sort on each of the subarrays. Merge each of the subarrays using the method Sedgwick recommends in (ii). (This is where I encounter the problem of where to store the results after the merge.) This leads to wanting to increase the size of the auxiliary space needed to handle at least two subarrays at a time (for merging), but based on the specifications of the problem, that is not allowed. I have also considered using the original array as space for one subarray and using the auxiliary space for the second subarray. However, I can't envision a solution that does not end up overwriting the entries of the first subarray. Any ideas on other ways this can be done? NOTE: If this is suppose to be on StackOverflow.com, please let me know how I can move it. I posted here because the question was academic.

    Read the article

< Previous Page | 109 110 111 112 113 114 115 116 117 118 119 120  | Next Page >