Search Results

Search found 44940 results on 1798 pages for 'first rock'.

Page 119/1798 | < Previous Page | 115 116 117 118 119 120 121 122 123 124 125 126  | Next Page >

  • Word: MAC 2011, TOC on too many pages

    - by Mark
    I have a Word: MAC 2011 document where the bottom of the first 40 pages or so say "TOC: Page x". This notation appears to be in the Footer, as it is gray until I click on it (then the rest of the text goes gray instead). There is no TOC that I can see in the document, so I'm presuming someone tried to create one and messed things up. After the first 40 pages or so, all the other bottom of the page notations appear to be correct. (i.e. Chapter One, Chapter Two, etc.) How can I get those first 40 pages to be part of Chapter One rather than TOC?

    Read the article

  • Why does Windows Explorer highlight only second entry?

    - by normanius
    Why does Windows Explorer highlight the second but never the first entry if I use the keyboard for navigation? Example: let's look at a folder that contains the following entries a1 a2 a3 b1 b2 If I hit 'a' on the keyboard, the explorer highlights entry 'a2' instead of 'a1'. It works fine for 'b' with 'b1' (because it's not the first entry). Similarly, if I open a folder and use the arrow-down key to navigate then the first entry is skipped again. Why?! It's probable that I'm too stupid for this but this "feature" really annoys me!

    Read the article

  • How Do I Enable CUPS Browsing Across A Network?

    - by David Mackintosh
    I have a CUPS server with two print queues defined. Once this was defined, all the CUPS clients on the same subnet could see the two print queues automatically, no problem. Now I have a collection of machines on a separate subnet, reachable from the first subnet by a router. How do I enable CUPS browsing on the second set of machines so that they can see the print queues defined on the first machine? Let's call the server A.B.C.7. The first subnet is A.B.C.0/24. The second subnet is A.B.D.0/24, and there is a router with arms on both networks.

    Read the article

  • Pre-load MS Windows right-click menus and Start menu at startup

    - by Steve
    Hello brainy people. On my WinXP SP3 laptop (1.4Ghz 1.2GB ram), after I first log in, when I right-click in Windows Explorer and choose New, the submenu can take up to 15 seconds to load, which is a pain in the ass when you want to do a quick easy operation. After the submenu has loaded the first time, subsequent loads perform instantly, obviously as the menu has been cached. My question is: can these right-click menus (and the Start menu, which also takes some time to load the first time) be pre-loaded at Windows startup? Thanks.

    Read the article

  • Excel Matching problem with logic expression

    - by abelenky
    I have a block of data that represents the steps in a process and the possible errors: ProcessStep Status FeesPaid OK FormRecvd OK RoleAssigned OK CheckedIn Not Checked In. ReadyToStart Not Ready for Start I want to find the first Status that is not "OK". I have attempted this: =Match("<>""OK""", StatusRange, 0) which is supposed to return the index of the first element in the range that is NOT-EQUAL (<) to "OK" But this doesn't work, instead returning #N/A. I expect it to return 4 (index #4, in a 1-based index, representing that CheckedIn is the first non-OK element) Any ideas how to do this?

    Read the article

  • Is there a reason the partition tool GParted doesn't show a percentage finish number initially?

    - by Jian Lin
    I am using GParted more, and it seems to do a reliable work. I just wonder why if the tasks is to resize a 250GB partition to 190GB, and then create a new partition, the first 10, 15 minutes, there is only a blue bar moving left and right, but there won't be an indicator showing how many percent is done. Then after that 10 to 15 minutes, it does show 1:05:00 left to finish the job. Update: at first I thought there is no percentage or time remaining at all... but after waiting for 10, 15 mintues, it does show. I just wonder why it didn't show at first.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Boot from Second SATA Drive

    - by Chris
    I have a Dell Precision 490 Workstation, and I just had my other question answered, Install Ubuntu to drive B without impacting drive A, and now I'm having a boot sequence issue. The external drive is great, boots up fine on my laptop, but how do I tell my desktop to boot from my second SATA drive and not the first SATAdrive. My drive configuration as follows SATA-0: Windows SATA-1: DVDR SATA-2: Ubuntu When I choose the boot menu, the option I have is "Internal Hard Drive". I assume it searches all drives, and loads the first bootable one it finds (which happens to be Windows), but I'd like to be able to select the drive from a list. Has anyone experienced this? Is possible without disabling the first hard drive in the BIOS?

    Read the article

  • ESX Firewall Command Troubles

    - by John
    Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

    Read the article

  • Sudo asks for password twice with LDAP authentication

    - by Gnudiff
    I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

    Read the article

  • How to convert excel individual cell values to percentage change values over time

    - by cgalloway
    I have two years of excel data showing daily share prices of a particular stock. I want to change those values to show percentage change (on a daily basis) from the zero date (ie the first day of the two year period). I know that the formula for showing daily percentage change would be (second day/first day -1) and that I can click and drag on that formula to extend over the rest of the two-year time period. The formula I want would be, basically, (each day/first day-1). Is there an easy way to automate the script so I dont have to type it out 730 times?

    Read the article

  • Merged rows in column, bottom row fixed height

    - by Styxxy
    I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

    Read the article

  • Asterisk Register username with special character like "@"

    - by Najibul Huq
    I am using a SIP provider that has provided me with a username like: [email protected] (Note this is only the username part) And has a numerical password. My Register string looks something like this: [email protected]:[email protected] But this is not working, as asterisk is only sending the first part +112223344 before the first @. My provider is adamant about having the full form of it. This is the first time I am facing this issue that is quite unusual for me. Please help.

    Read the article

  • Ubuntu 12.04 on Amazon EC2: /dev/xvda1 will be checked for errors at next reboot?

    - by cwd
    I'm running the lastest Ubuntu 12.04 AMI (ami-a29943cb) from Canonical on Amazon EC2 and quite often when I log in I get the message: *** /dev/xvda1 will be checked for errors at next reboot *** I have read a bunch of documentation on this and seem to understand that every so many reboots (around 37 see Mount count / Maximum mount count below) Ubuntu wants to check a disk for errors. I can see that by using dumpe2fs -h /dev/xvda1 (reference) to get information such as: Last mounted on: / Filesystem UUID: 1ad27d06-4ecf-493d-bb19-4710c3caf924 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype needs_recovery extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: (none) Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 524288 Block count: 2097152 Reserved block count: 104857 Free blocks: 1778055 Free inodes: 482659 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 511 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 Flex block group size: 16 Filesystem created: Tue Apr 24 03:07:48 2012 Last mount time: Thu Nov 8 03:17:58 2012 Last write time: Tue Apr 24 03:08:52 2012 Mount count: 3 Maximum mount count: 37 Last checked: Tue Apr 24 03:07:48 2012 Check interval: 15552000 (6 months) Next check after: Sun Oct 21 03:07:48 2012 Lifetime writes: 2454 MB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: 0a25e04c-6169-4d68-bfa6-a1acd8e39632 Journal backup: inode blocks Journal features: journal_incompat_revoke Journal size: 128M Journal length: 32768 Journal sequence: 0x0000158b Journal start: 1 I've tried these things to get rid of the message and usually the badblocks is what does it for me: Run this command and reboot: sudo touch /forcefsck Run badblocks to check the disk: badblocks /dev/sda1 Edit /etc/fstab and change the last "0" which is the fs_passno column accordingly and then reboot: The root filesystem should be specified with a fs_passno of 1, and other filesystems should have a fs_passno of 2. I don't understand: If this is a virtual drive shouldn't it be less prone to errors? Was the image created with one of the flags set? If not what is triggering it? Why is fs_passno set to 0 on Amazon EC2 Ubuntu images? This is not the first one that is like this.

    Read the article

  • Sublinear Extra Space MergeSort

    - by hulkmeister
    I am reviewing basic algorithms from a book called Algorithms by Robert Sedgewick, and I came across a problem in MergeSort that I am, sad to say, having difficulty solving. The problem is below: Sublinear Extra Space. Develop a merge implementation that reduces that extra space requirement to max(M, N/M), based on the following idea: Divide the array into N/M blocks of size M (for simplicity in this description, assume that N is a multiple of M). Then, (i) considering the blocks as items with their first key as the sort key, sort them using selection sort; and (ii) run through the array merging the first block with the second, then the second block with the third, and so forth. The problem I have with the problem is that based on the idea Sedgewick recommends, the following set of arrays will not be sorted: {0, 10, 12}, {3, 9, 11}, {5, 8, 13}. The algorithm I use is the following: Divide the full array into subarrays of size M. Run Selection Sort on each of the subarrays. Merge each of the subarrays using the method Sedgwick recommends in (ii). (This is where I encounter the problem of where to store the results after the merge.) This leads to wanting to increase the size of the auxiliary space needed to handle at least two subarrays at a time (for merging), but based on the specifications of the problem, that is not allowed. I have also considered using the original array as space for one subarray and using the auxiliary space for the second subarray. However, I can't envision a solution that does not end up overwriting the entries of the first subarray. Any ideas on other ways this can be done? NOTE: If this is suppose to be on StackOverflow.com, please let me know how I can move it. I posted here because the question was academic.

    Read the article

  • Parallelism in .NET – Part 4, Imperative Data Parallelism: Aggregation

    - by Reed
    In the article on simple data parallelism, I described how to perform an operation on an entire collection of elements in parallel.  Often, this is not adequate, as the parallel operation is going to be performing some form of aggregation. Simple examples of this might include taking the sum of the results of processing a function on each element in the collection, or finding the minimum of the collection given some criteria.  This can be done using the techniques described in simple data parallelism, however, special care needs to be taken into account to synchronize the shared data appropriately.  The Task Parallel Library has tools to assist in this synchronization. The main issue with aggregation when parallelizing a routine is that you need to handle synchronization of data.  Since multiple threads will need to write to a shared portion of data.  Suppose, for example, that we wanted to parallelize a simple loop that looked for the minimum value within a dataset: double min = double.MaxValue; foreach(var item in collection) { double value = item.PerformComputation(); min = System.Math.Min(min, value); } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } This seems like a good candidate for parallelization, but there is a problem here.  If we just wrap this into a call to Parallel.ForEach, we’ll introduce a critical race condition, and get the wrong answer.  Let’s look at what happens here: // Buggy code! Do not use! double min = double.MaxValue; Parallel.ForEach(collection, item => { double value = item.PerformComputation(); min = System.Math.Min(min, value); }); This code has a fatal flaw: min will be checked, then set, by multiple threads simultaneously.  Two threads may perform the check at the same time, and set the wrong value for min.  Say we get a value of 1 in thread 1, and a value of 2 in thread 2, and these two elements are the first two to run.  If both hit the min check line at the same time, both will determine that min should change, to 1 and 2 respectively.  If element 1 happens to set the variable first, then element 2 sets the min variable, we’ll detect a min value of 2 instead of 1.  This can lead to wrong answers. Unfortunately, fixing this, with the Parallel.ForEach call we’re using, would require adding locking.  We would need to rewrite this like: // Safe, but slow double min = double.MaxValue; // Make a "lock" object object syncObject = new object(); Parallel.ForEach(collection, item => { double value = item.PerformComputation(); lock(syncObject) min = System.Math.Min(min, value); }); This will potentially add a huge amount of overhead to our calculation.  Since we can potentially block while waiting on the lock for every single iteration, we will most likely slow this down to where it is actually quite a bit slower than our serial implementation.  The problem is the lock statement – any time you use lock(object), you’re almost assuring reduced performance in a parallel situation.  This leads to two observations I’ll make: When parallelizing a routine, try to avoid locks. That being said: Always add any and all required synchronization to avoid race conditions. These two observations tend to be opposing forces – we often need to synchronize our algorithms, but we also want to avoid the synchronization when possible.  Looking at our routine, there is no way to directly avoid this lock, since each element is potentially being run on a separate thread, and this lock is necessary in order for our routine to function correctly every time. However, this isn’t the only way to design this routine to implement this algorithm.  Realize that, although our collection may have thousands or even millions of elements, we have a limited number of Processing Elements (PE).  Processing Element is the standard term for a hardware element which can process and execute instructions.  This typically is a core in your processor, but many modern systems have multiple hardware execution threads per core.  The Task Parallel Library will not execute the work for each item in the collection as a separate work item. Instead, when Parallel.ForEach executes, it will partition the collection into larger “chunks” which get processed on different threads via the ThreadPool.  This helps reduce the threading overhead, and help the overall speed.  In general, the Parallel class will only use one thread per PE in the system. Given the fact that there are typically fewer threads than work items, we can rethink our algorithm design.  We can parallelize our algorithm more effectively by approaching it differently.  Because the basic aggregation we are doing here (Min) is communitive, we do not need to perform this in a given order.  We knew this to be true already – otherwise, we wouldn’t have been able to parallelize this routine in the first place.  With this in mind, we can treat each thread’s work independently, allowing each thread to serially process many elements with no locking, then, after all the threads are complete, “merge” together the results. This can be accomplished via a different set of overloads in the Parallel class: Parallel.ForEach<TSource,TLocal>.  The idea behind these overloads is to allow each thread to begin by initializing some local state (TLocal).  The thread will then process an entire set of items in the source collection, providing that state to the delegate which processes an individual item.  Finally, at the end, a separate delegate is run which allows you to handle merging that local state into your final results. To rewriting our routine using Parallel.ForEach<TSource,TLocal>, we need to provide three delegates instead of one.  The most basic version of this function is declared as: public static ParallelLoopResult ForEach<TSource, TLocal>( IEnumerable<TSource> source, Func<TLocal> localInit, Func<TSource, ParallelLoopState, TLocal, TLocal> body, Action<TLocal> localFinally ) The first delegate (the localInit argument) is defined as Func<TLocal>.  This delegate initializes our local state.  It should return some object we can use to track the results of a single thread’s operations. The second delegate (the body argument) is where our main processing occurs, although now, instead of being an Action<T>, we actually provide a Func<TSource, ParallelLoopState, TLocal, TLocal> delegate.  This delegate will receive three arguments: our original element from the collection (TSource), a ParallelLoopState which we can use for early termination, and the instance of our local state we created (TLocal).  It should do whatever processing you wish to occur per element, then return the value of the local state after processing is completed. The third delegate (the localFinally argument) is defined as Action<TLocal>.  This delegate is passed our local state after it’s been processed by all of the elements this thread will handle.  This is where you can merge your final results together.  This may require synchronization, but now, instead of synchronizing once per element (potentially millions of times), you’ll only have to synchronize once per thread, which is an ideal situation. Now that I’ve explained how this works, lets look at the code: // Safe, and fast! double min = double.MaxValue; // Make a "lock" object object syncObject = new object(); Parallel.ForEach( collection, // First, we provide a local state initialization delegate. () => double.MaxValue, // Next, we supply the body, which takes the original item, loop state, // and local state, and returns a new local state (item, loopState, localState) => { double value = item.PerformComputation(); return System.Math.Min(localState, value); }, // Finally, we provide an Action<TLocal>, to "merge" results together localState => { // This requires locking, but it's only once per used thread lock(syncObj) min = System.Math.Min(min, localState); } ); Although this is a bit more complicated than the previous version, it is now both thread-safe, and has minimal locking.  This same approach can be used by Parallel.For, although now, it’s Parallel.For<TLocal>.  When working with Parallel.For<TLocal>, you use the same triplet of delegates, with the same purpose and results. Also, many times, you can completely avoid locking by using a method of the Interlocked class to perform the final aggregation in an atomic operation.  The MSDN example demonstrating this same technique using Parallel.For uses the Interlocked class instead of a lock, since they are doing a sum operation on a long variable, which is possible via Interlocked.Add. By taking advantage of local state, we can use the Parallel class methods to parallelize algorithms such as aggregation, which, at first, may seem like poor candidates for parallelization.  Doing so requires careful consideration, and often requires a slight redesign of the algorithm, but the performance gains can be significant if handled in a way to avoid excessive synchronization.

    Read the article

  • CodePlex Daily Summary for Tuesday, March 09, 2010

    CodePlex Daily Summary for Tuesday, March 09, 2010New Projects.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: .NET Excel Wrapper encapsulates the complexity of working with multiple Excel objects giving you one central point to do all your processing. It h...Advancement Voyage: Advancement Voyage is a high quality RPG experience that provides all the advancement and voyaging that a player could hope for.ASP.Net Routing configuration: ASP.NET routing configuration enables you to configure the routes in the web.config bbinjest: bbinjestBuildUp: BuildUp is a build number increment tool for C# .net projects. It is run as a post build step in Visual Studio.Controlled Vocabulary: This project is devoted to creating tools to assist with Controlling Vocabulary in communication. The initial delivery is an Outlook 2010 Add-in w...CycleList: A replacement for the WPF ListBox Control. Displays only a single item and allows the user to change the selected item by clicking on it once. Very...Forensic Suite: A suite of security softwareFREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat is a live chat solution and its DotNetNuke Chat Module helps to embed a live chat room into website with DotNetNuke(DNN) integrated ...HouseFly experimental controls: Experimental controls for use in HouseFly.ICatalogAll: junkMidiStylus: MidiStylus allows you to control MIDI-enabled hardware or software using your pressure-sensitive pen tablet. The program maps the X position, Y po...myTunes: Search for your favorite artistsNColony - Pluggable Socialism?: NColony will maximize the use of MEF to create flexible application architectures through a suite of plug-in solutions. If MEF is an outlet for plu...Network Monitor Decryption Expert: NmDecrypt is a Network Monitor Expert which when given a trace with encrypted frames, a security certificate, and a passkey will create a new trace...occulo: occulo is a free steganography program, meant to embed files within images with optional encrytion. Open Ant: A implementation of a Open Source Ant which is created to show what is possible in the serious game AntMe! The First implementation of that ProjectProgramming Patterns by example: Design patterns provide solutions to common software design problems. This project will contain samples, written in c# and ruby, of each design pat...project4k: Developing bulk mail system storing email informationQuail - Selenium Remote Control Made Easy: Quail makes it easy for Quality Assurance departments write automated tests against web applications. Both HTML and Silverlight applications can b...RedBulb for XNA Framework: RedBulb is a collection of utility functions and classes that make writing games with XNA a lot easier. Key features: Console,GUI (Labels, Buttons,...RegExpress: RegExpress is a WPF application that combines interactive demos of regular expressions with slide content. This was designed for a user group prese...RemoveFolder: Small utility program to remove empty foldersScrumTFS: ScrumTFSSharePoint - Open internal link in new window list definition: A simple SharePoint list definition to render SharePoint internal links with the option to open them in a new window.SqlSiteMap4MVC: SqlSiteMapProvider for ASP.Net MVC.T Sina .NET Client: t.sina.com.cn api 新浪微博APITest-Lint-Extensions: Test Lint is a free Typemock VS 2010 Extension that finds common problems in your unit tests as you type them. this project will host extensions ...ThinkGearNET: ThinkGearNET is a library for easy usage of the Neurosky Mindset headset from .NET .Wiki to Maml: This project enables you to write wiki syntax and have it converted into MAML syntax for Sandcastle documentation projects.WPF Undo/Redo Framework: This project attempts to solve the age-old programmer problem of supporting unlimited undo/redo in an application, in an easily reusable manner. Th...WPFValidators: WPF Validators Validações de campos para WPFWSP Listener: The WSP listener is a windows service application which waits for new WSC and WSP files in a specific folder. If a new WSC and WSP file are added, ...New Releases.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: First Release: This is the first release which includes the main library release..NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: Updated Version: New Features:SetRangeValue using multidimensional array Print current worksheet Print all worksheets Format ranges background, color, alig...ArkSwitch: ArkSwitch v1.1.2: This release removes all memory reporting information, and is focused on stability.BattLineSvc: V2.1: - Fixed a bug where on system start-up, it would pop up a notification box to let you know the service started. Annoying! And fixed! - Fixed the ...BuildUp: BuildUp 1.0 Alpha 1: Use at your own risk!Not yet feature complete. Basic build incrementing and attribute overriding works. Still working on cascading build incremen...Controlled Vocabulary: 1.0.0.1: Initial Alpha Release. System Requirements Outlook 2010 .Net Framework 3.5 Installation 1. Close Outlook (Use Task Manager to ensure no running i...CycleList: CycleList: The binaries contain the .NET 3.5 DLL ONLY. Please download source for usage examples.FluentNHibernate.Search: 0.3 Beta: 0.3 Beta take the following changes : Mappings : - Field Mapping without specifying "Name" - Id Mapping without specifiying "Field" - Builtin Anal...FREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat DNN Chat Module: With FREE DotNetNuke Chat Module of 123 Flash Chat, webmaster will be assist to add a chat room into DotNetNuke instantly and help to attract more ...GameStore League Manager: League Manager 1.0 release 3: This release includes a full installer so that you can get your league running faster and generate interest quicker.iExporter - iTunes playlist exporting: iExporter gui v2.3.1.0 - console v1.2.1.0: Paypal donate! Solved a big bug for iExporter ( Gui & Console ) When a track isn't located under the main iTunes library, iExporter would crash! ...jQuery.cssLess: jQuery.cssLess 0.3: New - Removed the dependency from XRegExp - Added comment support (both CSS style and C style) - Optimised it for speed - Added speed test TOD...jQuery.cssLess: jQuery.cssLess 0.4: NEW - @import directive - preserving of comments in the resulting CSS - code refactoring - more class oriented approach TODO - implement operation...MapWindow GIS: MapWindow 6.0 msi (March 8): Rewrote the shapefile saving code in the indexed case so that it uses the shape indices rather than trying to create features. This should allow s...MidiStylus: MidiStylus 0.5.1: MidiStylus Beta 0.5.1 This release contains basic functionality for transmitting MIDI data based on X position, Y position, and pressure value rea...MiniTwitter: 1.09.1: MiniTwitter 1.09.1 更新内容 修正 URL に & が含まれている時に短縮 URL がおかしくなるバグを修正Mosaictor: first executable: .exe file of the app in its current state. Mind you that this will likely be highly unstable due to heaps of uncaught errors.MvcContrib a Codeplex Foundation project: T4MVC: T4MVC is a T4 template that generates strongly typed helpers for ASP.NET MVC. You can download it below, and check out the documention here.N2 CMS: 2.0 beta: Major Changes ASP.NET MVC 2 templates Refreshed management UI LINQ support Performance improvements Auto image resize Upgrade Make a comp...NotesForGallery: ASP.NET AJAX Photo Gallery Control: NotesForGallery 2.0: PresentationNotesForGallery is an open source control on top of the Microsoft ASP.NET AJAX framework for easy displaying image galleries in the as...occulo: occulo 0.1 binaries: Windows binaries. Tested on Windows XP SP2.occulo: occulo 0.1 source: Initial source release.Open NFe: DANFE 1.9.5: Ajuste de layout e correção dos campos de ISS.patterns & practices Web Client Developer Guidance: Web Application Guidance -- March 8th Drop: This iteration we focused on documentation and bug fixes.PoshConsole: PoshConsole 2.0 Beta: With this release, I am refocusing PoshConsole... It will be a PowerShell 2 host, without support for PowerShell 1.0 I have used some of the new P...Quick Performance Monitor: QPerfmon 1.1: Now you can specify different updating frequencies.RedBulb for XNA Framework: Cipher Puzzle (Sample) Creators Club Package: RedBulb Sample Game: Cipher Puzzle http://bayimg.com/image/galgfaacb.jpgRedBulb for XNA Framework: RedBulbStarter (Base Code): This is the code you need to start with. Quick Start Guide: Download the latest version of RedBulb: http://redbulb.codeplex.com/releases/view/415...RoTwee: RoTwee 7.0.0.0 (Alpha): Now this version is under improvement of code structure and may be buggy. However movement of rotation is quite good in this version thanks to clea...SCSI Interface for Multimedia and Block Devices: Release 9 - Improvements and Bug Fixes: Changes I have made in this version: Fixed INQUIRY command timeout problem Lowered ISOBurn's memory usage significantly by not explicitly setting...SharePoint - Open internal link in new window list definition: Open link in new window list definition: First release, with english and italian localization supportSharePoint Outlook Connector: Version 1.2.3.2: Few bug fixing and some ui enhancementsSysI: sysi, release build: Better than ever -- now allows for escalation to adminThe Silverlight Hyper Video Player [http://slhvp.com]: Beta 1: Beta (1.1) The code is ready for intensive testing. I will update the code at least every second day until we are ready to freeze for V1, which wi...Truecrafting: Truecrafting 0.52: fixed several trinkets that broke just before i released 0.51, sorry fixed water elemental not doing anything while summoned if not using glyph o...Truecrafting: Truecrafting 0.53: fixed mp5 calculations when gear contained mp5 and made the formulas more efficient no need to rebuild profiles with this release if placed in th...umbracoSamplePackageCreator (beta): Working Beta: For Visual Studio 2008 creating packages for Umbraco 4.0.3.VCC: Latest build, v2.1.30307.0: Automatic drop of latest buildVCC: Latest build, v2.1.30308.0: Automatic drop of latest buildVOB2MKV: vob2mkv-1.0.3: This is a maintenance update of the VOB2MKV utility. The MKVMUX filter now describes the cluster locations using a separate SeekHead element at th...WPFValidators: WPFValidators 1.0 Beta: Primeira versão do componente ainda em Beta, pode ser utilizada em produção pois esta funcionando bem e as futuras alterações não sofreram muito im...WSDLGenerator: WSDLGenerator 0.0.06: - Added option to generate SharePoint compatible *disco.aspx file. - Changed commandline optionsWSP Listener: WSP Listener version 1.0.0.0: First version of the WSP Listener includes: Easy cop[y paste installation of WSP solutions Extended logging E-mail when installation is finish...Yet another pali text reader: Pali Text Reader App v1.1: new features/updates + search history is now a tab + format codes in dictionary + add/edit terms in the dictionary + pali keyboard inserts symbols...Most Popular ProjectsMetaSharpi4o - Indexed LINQResExBraintree Client LibraryGeek's LibrarySharepoint Feature ManagerConfiguration ManagementOragon Architecture SqlBuilderTerrain Independant Navigating Automaton v2.0WBFS ManagerMost Active ProjectsUmbraco CMSRawrSDS: Scientific DataSet library and toolsBlogEngine.NETjQuery Library for SharePoint Web ServicesFasterflect - A Fast and Simple Reflection APIFarseer Physics Enginepatterns & practices – Enterprise LibraryTeam FTW - Software ProjectIonics Isapi Rewrite Filter

    Read the article

  • Please guide this self-taught Web Developer.

    - by ChickenPuke
    One of the major regrets in life is that I didn't do something with my introversion. I didn't manage to get past the first year of college because of that. I have chosen the path where there are no video games and other time sinks, all I have is the internet to quench my thirst of learning the ins and outs of the field of Web Developing/Designing. Though currently, I'm taking a Web Design Associate course at one of the best Computer Arts and this is the last month of the class. Even though I'm still a sapling, I love this field so much. So basically, At school I'm learning web design while at home I'm teaching myself web-developing. First thing first, returning to college seems impossible at the moment because of some financial problems. I'm pretty comfortable with CSS and HTML and I'm into PHP/MySQL at the moment. Could you please provide me a web-development Curriculum to follow. And do I need to learn about the theories behind? And I think I'm still young(I'm 18 at the time of writing). Is it a good thing or bad thing for choosing this path? I'm glad with my decision but in all honesty, I'm worrying about my future and employment because I'm an undergrad, coming from a country where companies are degree b!tches, it saddens me so. Thank you. (My questions are the bold parts. )

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • CodePlex Daily Summary for Friday, March 05, 2010

    CodePlex Daily Summary for Friday, March 05, 2010New Projects.svn Folders Cleanup Tool: dotSVN Cleanup is a tool that allows you to remove the .svn folders . Just click, browse, say abracadabra ...and the magic is done. Have fun with...Accord: The Accord framework creates an easy we to integrate any Dependency Injection framework into your project, while abstracting the details of your im...Asp.net MVC Lab: Try asp.net mvc outASP.NET Themes management with Webforms: The provided source is an example for how to use themes in ASP.NET Webforms. this source is the "up to date" support for the article I wroteB&W Port Scanner: B&W Port Scanner (formerly Net Inspector) is a fast TCP Port scan utility. The main idea is support of customizable operations to be performed f...BizTalk SWAT - Simple Web Activity Tracker: This is a web based version of BizTalk HAT. The concept is designed to be able to share and enable sharing of orchestration info easily. Some of th...C# Linear Hash Table: A C# dictionary-like implementation of a linear hash table. It is more memory efficiant than the .NET dictionary, and also almost as fast. NOTE: On...DBF Import Export Wizard: DBF Import Export Wizard is a tool for anyone needing to import DBF files into SQL Server or to export SQL Server tables to a DBF file. This proje...Domain as XML - Driven Development: Visual Studio Code Samples: Domain as XML - Driven Development: Visual Studio Code SamplesEasyDownload: This application allows to manage downloads handling an stack of files and several useful configurationsEos2: .FlightTickets: This application allows to buy flight ticketsFotofly PhotoViewer: A Silverlight control that uses the Fotofly metadata library to show the people in a photo (using Windows Live Photo Gallery People metadata) and a...Fujiy source code: Source code examplesGameSet: This application allows to play games with distributed users.Injectivity (Dependency Injection): Injectivity is a dependency injection framework (written in C#) with a strong focus on the ease of configuration and performance. Having been writt...Inventory: Keep track of inputs, materias and salesLoanTin.Com Source Code: LoanTin.Com - a Social Networking Website as same as Tumblr.com, based on source code of Loantiner Project, allow anyone can share anything to anyo...mysln: my solutions.NumTextBox: TextBox控件重写 之NumTextBox,主要实现的功能是,只允许输入数字,或String,Numeric,Currency,Decimal,Float,Double,Short,Int,Long 修改自:http://www.codeproject.com/KB/edit/num...Quick Performance Monitor: This small utility helps to monitor performance counters without using the full blown perfmon tool from Windows. It supports a number of command li...Runo: Runo ResearchSales: This application allows to manage a hardware storeScrewWiki Form Auth Provider: Enables your ASP.NET site to use Forms Authentication to integrate with your ScrewWiki. User management is performed on a parent site, and cookie i...SDS: Scientific DataSet library and tools: The SDS library makes it easy for .Net developers to read, write and share scalars, vectors, matrices and multidimensional grids which are very com...ShapeSweeper: Minesweeper-like game for the Zune HD. Each hidden object has three properties to discover--location, color, and shape--and all three must be corre...SilverlightExcel: an Excel file viewer in Silverlight 4: SilverlightExcel is a Silverlight application allowing you to open and view Excel files and also create graphs.sPWadmin: pwAdmin is an Web Interface based on JSP that uses the PW-Java API to control an PW-Server.Video Player control in Silverlight: A control for playing video in Silverlight 4 with chapters on timeline control. This player will be easily skinnable and customizable. More Featur...XNA Light Pre Pass Renderer: A demo/sample that shows how to write a light pre pass renderer in XNA.Zimms: Collaboration Site for friends, a code depot, and scratch padNew Releases.svn Folders Cleanup Tool: dotSVN Cleanup Tool: dotSVN Cleanup Tool executableAccord: Alpha: Initial build of the Accord framework.AcPrac: AcPrac Ver 0.1: The first version of AcPrac. It is not fully functional, but rather a version to get the bugs out. Please report all bugs.ASP.NET: ASP.NET Browser Definition Files: This download contains: ASP.NET 4 Browser Definition Files -- You can use the new ASP.NET 4 browser definition files with earlier versions of ASP....B&W Port Scanner: Black`n`White Port Scanner 1.0: B&W Port Scanner 1.0 Final Release Date: 03.03.2010 Black`n`WhiteBizTalk SWAT - Simple Web Activity Tracker: BizTalk SWAT: This is a web based version of BizTalk HAT. The concept is designed to be able to share and enable sharing of orchestration info easily. It uses th...BTP Tools: CSB+CUV+HCSB dict files 2010-03-04: 5. is now missing a space between the Strong’s number and the Count: >CSB Translation: 圣所 7, 至圣所G39+G394 it should be: CSB Translation: 圣所 7, 至圣所G...C# Linear Hash Table: Linear Hash Table: First working version of the Linear Hash Table.Cassiopeia: WinTools 1.0 beta: First ReleaseComposure: Caliburn-44007-trunk-vs2010.net40: This is a very simple conversion of the Caliburn trunk (rev 44007) for use in Visual Studio 2010 RC1 built against .NET40. Because the conversion w...Cover Creator: CoverCreator 1.3.0: English and Polish version. Functionality to add image to the front page. Load / save covers.DBF Import Export Wizard: DBF Import Export Wizard Source Code: Version 0.1.0.3DBF Import Export Wizard: DBF_Import_Export_Wizard Setup 0.1.0.3: Zip file contains Setup.exeESB Toolkit Extensions: Tellago BizTalk ESB 2.0 Toolkit Extensions v0.2: Windows Installer file that installs Library on a BizTalk ESB 2.0 system. This Install automatically configures the esb.config to use the new compo...Fotofly PhotoViewer: Fotofly Photoview v0.1: The first public release. Based on a Silverlight application I have been using for over a year at www.tassography.com. This version uses Fotofly v0...HPC with GPUs applied to CG: Cuda Soft Bodies simulation: Cuda src for soft bodiesHPC with GPUs applied to CG: Full Soft Bodies src: full src code for soft bodies simulationInjectivity (Dependency Injection): 2.8.166.2135: Release 2.8.166.2135 of the Injectivity dependency injection framework.Line Counter: 1.5 (Code Outline Preview): This version contains preview of the code outline feature, you can now view C# code outline within Line Counter. Note that the code outline now onl...Micajah Mindtouch Deki Wiki Copier: MicajahWikiCopier: You should use the following line arguments: WikiCopier.exe "http://oldwikiwithdata.wik.is/@api/deki" "login" "password" "http://newwiki.somename.l...ncontrols: Alpha 0.4.0.1: Added some example on the Console Project.NumTextBox: NumTextBox初始版本: TextBox控件重写 之NumTextBox,主要实现的功能是,只允许输入数字,或String,Numeric,Currency,Decimal,Float,Double,Short,Int,Long 此为初始版本PSCodeplex: PS CodePlex 0.2: PS CodePlex 0.2 has some breaking changes to the parameters. A few of the parameters are renamed and a few are made as switch parameters. Add-Rele...Quick Performance Monitor: QPerfMon First release - Version 1.0.0: The first release of the utility.RapidWebDev - .NET Enterprise Software Development Infrastructure: ProductManagement Quick Sample 0.2: This is a sample product management application to demonstrate how to develop enterprise software in RapidWebDev. The glossary of the system are ro...ScrewWiki Form Auth Provider: ScrewWiki Forms Authentication: Initial ReleaseSee.Sharper: See.Sharper.Docs-1.10.3.4: HTML documentation (including Doxygen project)See.Sharper: See.Sharper-1.10.3.4: Solution (Source files, debug and release binaries)Solar.Generic: Solar.Generic 0.8.0.0 Beta (Revised, Renamed): Solar.Generic 0.8.0.0 (Revised & Renamed) Renamed project from Solar.Commons to Solar.Generic. Project solution file is now in format of Visual ...Solar.Security: Solar.Security 1.1.0.0: Performed several major refactorings of code base. Stripped In-Memory implementation of IConfiguration interface of transactional behavior due to...sPWadmin: pwAdmin v0.7: -Star System Simulator: Star System Simulator 2.3: Changes in this release: Fixed several localisation issues. Features in this release: Model star systems in 3D. Euler-Cromer method. Improved...SysI: sysi, stable and ready: This time for sure.TheWhiteAmbit: TheWhiteAmbit - Demo: Two little demos demonstrating: - fast realtime raytracing - generating bent normals for shading (CUDA capable GPU needed = nVidia GeForce >8x00)VsTortoise - a TortoiseSVN add-in for Microsoft Visual Studio: VsTortoise Build 22 Beta: Build 22 (beta) New: Visual Studio 2010 RC support (VsTortoise for Visual Studio 2010 RC screenshots) New: VsTortoise integrates in to Solution E...WinMergeFS: WinMergeFS 0.1.42128alpha: WinMergeFS provides AuFS functionality for windows. With WinMergeFS users can mount multiple directories into a virtual drive. Plugin based root se...WSDLGenerator: WSDLGenerator 0.0.0.2: - Bugs fixed - Code refactored - Added support for custom typesXNA Light Pre Pass Renderer: LightPrePassRendererXNA: Zipped source code for the light pre pass renderer made with XNA.Most Popular ProjectsMetaSharpRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)LiveUpload to FacebookASP.NETMicrosoft SQL Server Community & SamplesMost Active ProjectsUmbraco CMSRawrBlogEngine.NETSDS: Scientific DataSet library and toolsMapWindow GISpatterns & practices – Enterprise LibraryjQuery Library for SharePoint Web ServicesIonics Isapi Rewrite FilterMDT Web FrontEndDiffPlex - a .NET Diff Generator

    Read the article

  • Ten - oh, wait, eleven - Eleven things you should know about the ASP.NET Fall 2012 Update

    - by Jon Galloway
    Today, just a little over two months after the big ASP.NET 4.5 / ASP.NET MVC 4 / ASP.NET Web API / Visual Studio 2012 / Web Matrix 2 release, the first preview of the ASP.NET Fall 2012 Update is out. Here's what you need to know: There are no new framework bits in this release - there's no change or update to ASP.NET Core, ASP.NET MVC or Web Forms features. This means that you can start using it without any updates to your server, upgrade concerns, etc. This update is really an update to the project templates and Visual Studio tooling, conceptually similar to the ASP.NET MVC 3 Tools Update. It's a relatively lightweight install. It's a 41MB download. I've installed it many times and usually takes 5-7 minutes; it's never required a reboot. It adds some new project templates to ASP.NET MVC: Facebook Application and Single Page Application templates. It adds a lot of cool enhancements to ASP.NET Web API. It adds some tooling that makes it easy to take advantage of features like SignalR, Friendly URLs, and Windows Azure Authentication. Most of the new features are installed via NuGet packages. Since ASP.NET is open source, nightly NuGet packages are available, and the roadmap is published, most of this has really been publicly available for a while. The official name of this drop is the ASP.NET Fall 2012 Update BUILD Prerelease. Please do not attempt to say that ten times fast. While the EULA doesn't prohibit it, it WILL legally change your first name to Scott. As with all new releases, you can find out everything you need to know about the Fall Update at http://asp.net/vnext (especially the release notes!) I'm going to be showing all of this off, assisted by special guest code monkey Scott Hanselman, this Friday at BUILD: Bleeding edge ASP.NET: See what is next for MVC, Web API, SignalR and more… (and I've heard it will be livestreamed). Let's look at some of those things in more detail. No new bits ASP.NET 4.5, MVC 4 and Web API have a lot of great core features. I see the goal of this update release as making it easier to put those features to use to solve some useful scenarios by taking advantage of NuGet packages and template code. If you create a new ASP.NET MVC application using one of the new templates, you'll see that it's using the ASP.NET MVC 4 RTM NuGet package (4.0.20710.0): This means you can install and use the Fall Update without any impact on your existing projects and no worries about upgrading or compatibility. New Facebook Application Template ASP.NET MVC 4 (and ASP.NET 4.5 Web Forms) included the ability to authenticate your users via OAuth and OpenID, so you could let users log in to your site using a Facebook account. One of the new changes in the Fall Update is a new template that makes it really easy to create full Facebook applications. You could create Facebook application in ASP.NET already, you'd just need to go through a few steps: Search around to find a good Facebook NuGet package, like the Facebook C# SDK (written by my friend Nathan Totten and some other Facebook SDK brainiacs). Read the Facebook developer documentation to figure out how to authenticate and integrate with them. Write some code, debug it and repeat until you got something working. Get started with the application you'd originally wanted to write. What this template does for you: eliminate steps 1-3. Erik Porter, Nathan and some other experts built out the Facebook Application template so it automatically pulls in and configures the Facebook NuGet package and makes it really easy to take advantage of it in an ASP.NET MVC application. One great example is the the way you access a Facebook user's information. Take a look at the following code in a File / New / MVC / Facebook Application site. First, the Home Controller Index action: [FacebookAuthorize(Permissions = "email")] public ActionResult Index(MyAppUser user, FacebookObjectList<MyAppUserFriend> userFriends) { ViewBag.Message = "Modify this template to jump-start your Facebook application using ASP.NET MVC."; ViewBag.User = user; ViewBag.Friends = userFriends.Take(5); return View(); } First, notice that there's a FacebookAuthorize attribute which requires the user is authenticated via Facebook and requires permissions to access their e-mail address. It binds to two things: a custom MyAppUser object and a list of friends. Let's look at the MyAppUser code: using Microsoft.AspNet.Mvc.Facebook.Attributes; using Microsoft.AspNet.Mvc.Facebook.Models; // Add any fields you want to be saved for each user and specify the field name in the JSON coming back from Facebook // https://developers.facebook.com/docs/reference/api/user/ namespace MvcApplication3.Models { public class MyAppUser : FacebookUser { public string Name { get; set; } [FacebookField(FieldName = "picture", JsonField = "picture.data.url")] public string PictureUrl { get; set; } public string Email { get; set; } } } You can add in other custom fields if you want, but you can also just bind to a FacebookUser and it will automatically pull in the available fields. You can even just bind directly to a FacebookUser and check for what's available in debug mode, which makes it really easy to explore. For more information and some walkthroughs on creating Facebook applications, see: Deploying your first Facebook App on Azure using ASP.NET MVC Facebook Template (Yao Huang Lin) Facebook Application Template Tutorial (Erik Porter) Single Page Application template Early releases of ASP.NET MVC 4 included a Single Page Application template, but it was removed for the official release. There was a lot of interest in it, but it was kind of complex, as it handled features for things like data management. The new Single Page Application template that ships with the Fall Update is more lightweight. It uses Knockout.js on the client and ASP.NET Web API on the server, and it includes a sample application that shows how they all work together. I think the real benefit of this application is that it shows a good pattern for using ASP.NET Web API and Knockout.js. For instance, it's easy to end up with a mess of JavaScript when you're building out a client-side application. This template uses three separate JavaScript files (delivered via a Bundle, of course): todoList.js - this is where the main client-side logic lives todoList.dataAccess.js - this defines how the client-side application interacts with the back-end services todoList.bindings.js - this is where you set up events and overrides for the Knockout bindings - for instance, hooking up jQuery validation and defining some client-side events This is a fun one to play with, because you can just create a new Single Page Application and hit F5. Quick, easy install (with one gotcha) One of the cool engineering changes for this release is a big update to the installer to make it more lightweight and efficient. I've been running nightly builds of this for a few weeks to prep for my BUILD demos, and the install has been really quick and easy to use. The install takes about 5 minutes, has never required a reboot for me, and the uninstall is just as simple. There's one gotcha, though. In this preview release, you may hit an issue that will require you to uninstall and re-install the NuGet VSIX package. The problem comes up when you create a new MVC application and see this dialog: The solution, as explained in the release notes, is to uninstall and re-install the NuGet VSIX package: Start Visual Studio 2012 as an Administrator Go to Tools->Extensions and Updates and uninstall NuGet. Close Visual Studio Navigate to the ASP.NET Fall 2012 Update installation folder: For Visual Studio 2012: Program Files\Microsoft ASP.NET\ASP.NET Web Stack\Visual Studio 2012 For Visual Studio 2012 Express for Web: Program Files\Microsoft ASP.NET\ASP.NET Web Stack\Visual Studio Express 2012 for Web Double click on the NuGet.Tools.vsix to reinstall NuGet This took me under a minute to do, and I was up and running. ASP.NET Web API Update Extravaganza! Uh, the Web API team is out of hand. They added a ton of new stuff: OData support, Tracing, and API Help Page generation. OData support Some people like OData. Some people start twitching when you mention it. If you're in the first group, this is for you. You can add a [Queryable] attribute to an API that returns an IQueryable<Whatever> and you get OData query support from your clients. Then, without any extra changes to your client or server code, your clients can send filters like this: /Suppliers?$filter=Name eq ‘Microsoft’ For more information about OData support in ASP.NET Web API, see Alex James' mega-post about it: OData support in ASP.NET Web API ASP.NET Web API Tracing Tracing makes it really easy to leverage the .NET Tracing system from within your ASP.NET Web API's. If you look at the \App_Start\WebApiConfig.cs file in new ASP.NET Web API project, you'll see a call to TraceConfig.Register(config). That calls into some code in the new \App_Start\TraceConfig.cs file: public static void Register(HttpConfiguration configuration) { if (configuration == null) { throw new ArgumentNullException("configuration"); } SystemDiagnosticsTraceWriter traceWriter = new SystemDiagnosticsTraceWriter() { MinimumLevel = TraceLevel.Info, IsVerbose = false }; configuration.Services.Replace(typeof(ITraceWriter), traceWriter); } As you can see, this is using the standard trace system, so you can extend it to any other trace listeners you'd like. To see how it works with the built in diagnostics trace writer, just run the application call some API's, and look at the Visual Studio Output window: iisexpress.exe Information: 0 : Request, Method=GET, Url=http://localhost:11147/api/Values, Message='http://localhost:11147/api/Values' iisexpress.exe Information: 0 : Message='Values', Operation=DefaultHttpControllerSelector.SelectController iisexpress.exe Information: 0 : Message='WebAPI.Controllers.ValuesController', Operation=DefaultHttpControllerActivator.Create iisexpress.exe Information: 0 : Message='WebAPI.Controllers.ValuesController', Operation=HttpControllerDescriptor.CreateController iisexpress.exe Information: 0 : Message='Selected action 'Get()'', Operation=ApiControllerActionSelector.SelectAction iisexpress.exe Information: 0 : Operation=HttpActionBinding.ExecuteBindingAsync iisexpress.exe Information: 0 : Operation=QueryableAttribute.ActionExecuting iisexpress.exe Information: 0 : Message='Action returned 'System.String[]'', Operation=ReflectedHttpActionDescriptor.ExecuteAsync iisexpress.exe Information: 0 : Message='Will use same 'JsonMediaTypeFormatter' formatter', Operation=JsonMediaTypeFormatter.GetPerRequestFormatterInstance iisexpress.exe Information: 0 : Message='Selected formatter='JsonMediaTypeFormatter', content-type='application/json; charset=utf-8'', Operation=DefaultContentNegotiator.Negotiate iisexpress.exe Information: 0 : Operation=ApiControllerActionInvoker.InvokeActionAsync, Status=200 (OK) iisexpress.exe Information: 0 : Operation=QueryableAttribute.ActionExecuted, Status=200 (OK) iisexpress.exe Information: 0 : Operation=ValuesController.ExecuteAsync, Status=200 (OK) iisexpress.exe Information: 0 : Response, Status=200 (OK), Method=GET, Url=http://localhost:11147/api/Values, Message='Content-type='application/json; charset=utf-8', content-length=unknown' iisexpress.exe Information: 0 : Operation=JsonMediaTypeFormatter.WriteToStreamAsync iisexpress.exe Information: 0 : Operation=ValuesController.Dispose API Help Page When you create a new ASP.NET Web API project, you'll see an API link in the header: Clicking the API link shows generated help documentation for your ASP.NET Web API controllers: And clicking on any of those APIs shows specific information: What's great is that this information is dynamically generated, so if you add your own new APIs it will automatically show useful and up to date help. This system is also completely extensible, so you can generate documentation in other formats or customize the HTML help as much as you'd like. The Help generation code is all included in an ASP.NET MVC Area: SignalR SignalR is a really slick open source project that was started by some ASP.NET team members in their spare time to add real-time communications capabilities to ASP.NET - and .NET applications in general. It allows you to handle long running communications channels between your server and multiple connected clients using the best communications channel they can both support - websockets if available, falling back all the way to old technologies like long polling if necessary for old browsers. SignalR remains an open source project, but now it's being included in ASP.NET (also open source, hooray!). That means there's real, official ASP.NET engineering work being put into SignalR, and it's even easier to use in an ASP.NET application. Now in any ASP.NET project type, you can right-click / Add / New Item... SignalR Hub or Persistent Connection. And much more... There's quite a bit more. You can find more info at http://asp.net/vnext, and we'll be adding more content as fast as we can. Watch my BUILD talk to see as I demonstrate these and other features in the ASP.NET Fall 2012 Update, as well as some other even futurey-er stuff!

    Read the article

  • Passing multiple simple POST Values to ASP.NET Web API

    - by Rick Strahl
    A few weeks backs I posted a blog post  about what does and doesn't work with ASP.NET Web API when it comes to POSTing data to a Web API controller. One of the features that doesn't work out of the box - somewhat unexpectedly -  is the ability to map POST form variables to simple parameters of a Web API method. For example imagine you have this form and you want to post this data to a Web API end point like this via AJAX: <form> Name: <input type="name" name="name" value="Rick" /> Value: <input type="value" name="value" value="12" /> Entered: <input type="entered" name="entered" value="12/01/2011" /> <input type="button" id="btnSend" value="Send" /> </form> <script type="text/javascript"> $("#btnSend").click( function() { $.post("samples/PostMultipleSimpleValues?action=kazam", $("form").serialize(), function (result) { alert(result); }); }); </script> or you might do this more explicitly by creating a simple client map and specifying the POST values directly by hand:$.post("samples/PostMultipleSimpleValues?action=kazam", { name: "Rick", value: 1, entered: "12/01/2012" }, $("form").serialize(), function (result) { alert(result); }); On the wire this generates a simple POST request with Url Encoded values in the content:POST /AspNetWebApi/samples/PostMultipleSimpleValues?action=kazam HTTP/1.1 Host: localhost User-Agent: Mozilla/5.0 (Windows NT 6.2; WOW64; rv:15.0) Gecko/20100101 Firefox/15.0.1 Accept: application/json Connection: keep-alive Content-Type: application/x-www-form-urlencoded; charset=UTF-8 X-Requested-With: XMLHttpRequest Referer: http://localhost/AspNetWebApi/FormPostTest.html Content-Length: 41 Pragma: no-cache Cache-Control: no-cachename=Rick&value=12&entered=12%2F10%2F2011 Seems simple enough, right? We are basically posting 3 form variables and 1 query string value to the server. Unfortunately Web API can't handle request out of the box. If I create a method like this:[HttpPost] public string PostMultipleSimpleValues(string name, int value, DateTime entered, string action = null) { return string.Format("Name: {0}, Value: {1}, Date: {2}, Action: {3}", name, value, entered, action); }You'll find that you get an HTTP 404 error and { "Message": "No HTTP resource was found that matches the request URI…"} Yes, it's possible to pass multiple POST parameters of course, but Web API expects you to use Model Binding for this - mapping the post parameters to a strongly typed .NET object, not to single parameters. Alternately you can also accept a FormDataCollection parameter on your API method to get a name value collection of all POSTed values. If you're using JSON only, using the dynamic JObject/JValue objects might also work. ModelBinding is fine in many use cases, but can quickly become overkill if you only need to pass a couple of simple parameters to many methods. Especially in applications with many, many AJAX callbacks the 'parameter mapping type' per method signature can lead to serious class pollution in a project very quickly. Simple POST variables are also commonly used in AJAX applications to pass data to the server, even in many complex public APIs. So this is not an uncommon use case, and - maybe more so a behavior that I would have expected Web API to support natively. The question "Why aren't my POST parameters mapping to Web API method parameters" is already a frequent one… So this is something that I think is fairly important, but unfortunately missing in the base Web API installation. Creating a Custom Parameter Binder Luckily Web API is greatly extensible and there's a way to create a custom Parameter Binding to provide this functionality! Although this solution took me a long while to find and then only with the help of some folks Microsoft (thanks Hong Mei!!!), it's not difficult to hook up in your own projects. It requires one small class and a GlobalConfiguration hookup. Web API parameter bindings allow you to intercept processing of individual parameters - they deal with mapping parameters to the signature as well as converting the parameters to the actual values that are returned. Here's the implementation of the SimplePostVariableParameterBinding class:public class SimplePostVariableParameterBinding : HttpParameterBinding { private const string MultipleBodyParameters = "MultipleBodyParameters"; public SimplePostVariableParameterBinding(HttpParameterDescriptor descriptor) : base(descriptor) { } /// <summary> /// Check for simple binding parameters in POST data. Bind POST /// data as well as query string data /// </summary> public override Task ExecuteBindingAsync(ModelMetadataProvider metadataProvider, HttpActionContext actionContext, CancellationToken cancellationToken) { // Body can only be read once, so read and cache it NameValueCollection col = TryReadBody(actionContext.Request); string stringValue = null; if (col != null) stringValue = col[Descriptor.ParameterName]; // try reading query string if we have no POST/PUT match if (stringValue == null) { var query = actionContext.Request.GetQueryNameValuePairs(); if (query != null) { var matches = query.Where(kv => kv.Key.ToLower() == Descriptor.ParameterName.ToLower()); if (matches.Count() > 0) stringValue = matches.First().Value; } } object value = StringToType(stringValue); // Set the binding result here SetValue(actionContext, value); // now, we can return a completed task with no result TaskCompletionSource<AsyncVoid> tcs = new TaskCompletionSource<AsyncVoid>(); tcs.SetResult(default(AsyncVoid)); return tcs.Task; } private object StringToType(string stringValue) { object value = null; if (stringValue == null) value = null; else if (Descriptor.ParameterType == typeof(string)) value = stringValue; else if (Descriptor.ParameterType == typeof(int)) value = int.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(Int32)) value = Int32.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(Int64)) value = Int64.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(decimal)) value = decimal.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(double)) value = double.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(DateTime)) value = DateTime.Parse(stringValue, CultureInfo.CurrentCulture); else if (Descriptor.ParameterType == typeof(bool)) { value = false; if (stringValue == "true" || stringValue == "on" || stringValue == "1") value = true; } else value = stringValue; return value; } /// <summary> /// Read and cache the request body /// </summary> /// <param name="request"></param> /// <returns></returns> private NameValueCollection TryReadBody(HttpRequestMessage request) { object result = null; // try to read out of cache first if (!request.Properties.TryGetValue(MultipleBodyParameters, out result)) { // parsing the string like firstname=Hongmei&lastname=Ge result = request.Content.ReadAsFormDataAsync().Result; request.Properties.Add(MultipleBodyParameters, result); } return result as NameValueCollection; } private struct AsyncVoid { } }   The ExecuteBindingAsync method is fired for each parameter that is mapped and sent for conversion. This custom binding is fired only if the incoming parameter is a simple type (that gets defined later when I hook up the binding), so this binding never fires on complex types or if the first type is not a simple type. For the first parameter of a request the Binding first reads the request body into a NameValueCollection and caches that in the request.Properties collection. The request body can only be read once, so the first parameter request reads it and then caches it. Subsequent parameters then use the cached POST value collection. Once the form collection is available the value of the parameter is read, and the value is translated into the target type requested by the Descriptor. SetValue writes out the value to be mapped. Once you have the ParameterBinding in place, the binding has to be assigned. This is done along with all other Web API configuration tasks at application startup in global.asax's Application_Start:GlobalConfiguration.Configuration.ParameterBindingRules .Insert(0, (HttpParameterDescriptor descriptor) => { var supportedMethods = descriptor.ActionDescriptor.SupportedHttpMethods; // Only apply this binder on POST and PUT operations if (supportedMethods.Contains(HttpMethod.Post) || supportedMethods.Contains(HttpMethod.Put)) { var supportedTypes = new Type[] { typeof(string), typeof(int), typeof(decimal), typeof(double), typeof(bool), typeof(DateTime) }; if (supportedTypes.Where(typ => typ == descriptor.ParameterType).Count() > 0) return new SimplePostVariableParameterBinding(descriptor); } // let the default bindings do their work return null; });   The ParameterBindingRules.Insert method takes a delegate that checks which type of requests it should handle. The logic here checks whether the request is POST or PUT and whether the parameter type is a simple type that is supported. Web API calls this delegate once for each method signature it tries to map and the delegate returns null to indicate it's not handling this parameter, or it returns a new parameter binding instance - in this case the SimplePostVariableParameterBinding. Once the parameter binding and this hook up code is in place, you can now pass simple POST values to methods with simple parameters. The examples I showed above should now work in addition to the standard bindings. Summary Clearly this is not easy to discover. I spent quite a bit of time digging through the Web API source trying to figure this out on my own without much luck. It took Hong Mei at Micrsoft to provide a base example as I asked around so I can't take credit for this solution :-). But once you know where to look, Web API is brilliantly extensible to make it relatively easy to customize the parameter behavior. I'm very stoked that this got resolved  - in the last two months I've had two customers with projects that decided not to use Web API in AJAX heavy SPA applications because this POST variable mapping wasn't available. This might actually change their mind to still switch back and take advantage of the many great features in Web API. I too frequently use plain POST variables for communicating with server AJAX handlers and while I could have worked around this (with untyped JObject or the Form collection mostly), having proper POST to parameter mapping makes things much easier. I said this in my last post on POST data and say it again here: I think POST to method parameter mapping should have been shipped in the box with Web API, because without knowing about this limitation the expectation is that simple POST variables map to parameters just like query string values do. I hope Microsoft considers including this type of functionality natively in the next version of Web API natively or at least as a built-in HttpParameterBinding that can be just added. This is especially true, since this binding doesn't affect existing bindings. Resources SimplePostVariableParameterBinding Source on GitHub Global.asax hookup source Mapping URL Encoded Post Values in  ASP.NET Web API© Rick Strahl, West Wind Technologies, 2005-2012Posted in Web Api  AJAX   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Exam 70-480 Study Material: Programming in HTML5 with JavaScript and CSS3

    - by Stacy Vicknair
    Here’s a list of sources of information for the different elements that comprise the 70-480 exam: General Resources http://www.w3schools.com (As pointed out in David Pallmann’s blog some of this content is unverified, but it is a decent source of information. For more about when it isn’t decent, see http://www.w3fools.com ) http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/ (A guy who did a lot of what I did already, sadly I found this halfway through finishing my resources list. This list is expertly put together so I would recommend checking it out.) http://davidpallmann.blogspot.com/2012/08/microsoft-certification-exam-70-480.html http://pluralsight.com/training/Courses (Yes, this isn’t free, but if you look at the course listing there is an entire section on HTML5, CSS3 and Javascript. You can always try the trial!)   Some of the links I put below will overlap with the other resources above, but I tried to find explanations that looked beneficial to me on links outside those already mentioned.   Test Breakdown Implement and Manipulate Document Structures and Objects (24%) Create the document structure. o This objective may include but is not limited to: structure the UI by using semantic markup, including for search engines and screen readers (Section, Article, Nav, Header, Footer, and Aside); create a layout container in HTML http://www.w3schools.com/html/html5_new_elements.asp   Write code that interacts with UI controls. o This objective may include but is not limited to: programmatically add and modify HTML elements; implement media controls; implement HTML5 canvas and SVG graphics http://www.w3schools.com/html/html5_canvas.asp http://www.w3schools.com/html/html5_svg.asp   Apply styling to HTML elements programmatically. o This objective may include but is not limited to: change the location of an element; apply a transform; show and hide elements   Implement HTML5 APIs. o This objective may include but is not limited to: implement storage APIs, AppCache API, and Geolocation API http://www.w3schools.com/html/html5_geolocation.asp http://www.w3schools.com/html/html5_webstorage.asp http://www.w3schools.com/html/html5_app_cache.asp   Establish the scope of objects and variables. o This objective may include but is not limited to: define the lifetime of variables; keep objects out of the global namespace; use the “this” keyword to reference an object that fired an event; scope variables locally and globally http://robertnyman.com/2008/10/09/explaining-javascript-scope-and-closures/ http://www.quirksmode.org/js/this.html   Create and implement objects and methods. o This objective may include but is not limited to: implement native objects; create custom objects and custom properties for native objects using prototypes and functions; inherit from an object; implement native methods and create custom methods http://www.javascriptkit.com/javatutors/object.shtml http://www.crockford.com/javascript/inheritance.html http://stackoverflow.com/questions/1635116/javascript-class-method-vs-class-prototype-method http://www.javascriptkit.com/javatutors/proto.shtml     Implement Program Flow (25%) Implement program flow. o This objective may include but is not limited to: iterate across collections and array items; manage program decisions by using switch statements, if/then, and operators; evaluate expressions http://www.javascriptkit.com/jsref/looping.shtml http://www.javascriptkit.com/javatutors/varshort.shtml http://www.javascriptkit.com/javatutors/switch.shtml   Raise and handle an event. o This objective may include but is not limited to: handle common events exposed by DOM (OnBlur, OnFocus, OnClick); declare and handle bubbled events; handle an event by using an anonymous function http://dev.w3.org/2006/webapi/DOM-Level-3-Events/html/DOM3-Events.html http://javascript.info/tutorial/bubbling-and-capturing   Implement exception handling. o This objective may include but is not limited to: set and respond to error codes; throw an exception; request for null checks; implement try-catch-finally blocks http://www.javascriptkit.com/javatutors/trycatch.shtml   Implement a callback. o This objective may include but is not limited to: receive messages from the HTML5 WebSocket API; use jQuery to make an AJAX call; wire up an event; implement a callback by using anonymous functions; handle the “this” pointer http://www.w3.org/TR/2011/WD-websockets-20110419/ http://www.html5rocks.com/en/tutorials/websockets/basics/ http://api.jquery.com/jQuery.ajax/   Create a web worker process. o This objective may include but is not limited to: start and stop a web worker; pass data to a web worker; configure timeouts and intervals on the web worker; register an event listener for the web worker; limitations of a web worker https://developer.mozilla.org/en-US/docs/DOM/Using_web_workers http://www.html5rocks.com/en/tutorials/workers/basics/   Access and Secure Data (26%) Validate user input by using HTML5 elements. o This objective may include but is not limited to: choose the appropriate controls based on requirements; implement HTML input types and content attributes (for example, required) to collect user input http://diveintohtml5.info/forms.html   Validate user input by using JavaScript. o This objective may include but is not limited to: evaluate a regular expression to validate the input format; validate that you are getting the right kind of data type by using built-in functions; prevent code injection http://www.regular-expressions.info/javascript.html http://msdn.microsoft.com/en-us/library/66ztdbe6(v=vs.94).aspx https://developer.mozilla.org/en-US/docs/JavaScript/Reference/Operators/typeof http://blog.stackoverflow.com/2008/06/safe-html-and-xss/ http://stackoverflow.com/questions/942011/how-to-prevent-javascript-injection-attacks-within-user-generated-html   Consume data. o This objective may include but is not limited to: consume JSON and XML data; retrieve data by using web services; load data or get data from other sources by using XMLHTTPRequest http://www.erichynds.com/jquery/working-with-xml-jquery-and-javascript/ http://www.webdevstuff.com/86/javascript-xmlhttprequest-object.html http://www.json.org/ http://stackoverflow.com/questions/4935632/how-to-parse-json-in-javascript   Serialize, deserialize, and transmit data. o This objective may include but is not limited to: binary data; text data (JSON, XML); implement the jQuery serialize method; Form.Submit; parse data; send data by using XMLHTTPRequest; sanitize input by using URI/form encoding http://api.jquery.com/serialize/ http://www.javascript-coder.com/javascript-form/javascript-form-submit.phtml http://stackoverflow.com/questions/327685/is-there-a-way-to-read-binary-data-into-javascript https://developer.mozilla.org/en-US/docs/JavaScript/Reference/Global_Objects/encodeURI     Use CSS3 in Applications (25%) Style HTML text properties. o This objective may include but is not limited to: apply styles to text appearance (color, bold, italics); apply styles to text font (WOFF and @font-face, size); apply styles to text alignment, spacing, and indentation; apply styles to text hyphenation; apply styles for a text drop shadow http://www.w3schools.com/css/css_text.asp http://www.w3schools.com/css/css_font.asp http://nicewebtype.com/notes/2009/10/30/how-to-use-css-font-face/ http://webdesign.about.com/od/beginningcss/p/aacss5text.htm http://www.w3.org/TR/css3-text/ http://www.css3.info/preview/box-shadow/   Style HTML box properties. o This objective may include but is not limited to: apply styles to alter appearance attributes (size, border and rounding border corners, outline, padding, margin); apply styles to alter graphic effects (transparency, opacity, background image, gradients, shadow, clipping); apply styles to establish and change an element’s position (static, relative, absolute, fixed) http://net.tutsplus.com/tutorials/html-css-techniques/10-css3-properties-you-need-to-be-familiar-with/ http://www.w3schools.com/css/css_image_transparency.asp http://www.w3schools.com/cssref/pr_background-image.asp http://ie.microsoft.com/testdrive/graphics/cssgradientbackgroundmaker/default.html http://www.w3.org/TR/CSS21/visufx.html http://www.barelyfitz.com/screencast/html-training/css/positioning/ http://davidwalsh.name/css-fixed-position   Create a flexible content layout. o This objective may include but is not limited to: implement a layout using a flexible box model; implement a layout using multi-column; implement a layout using position floating and exclusions; implement a layout using grid alignment; implement a layout using regions, grouping, and nesting http://www.html5rocks.com/en/tutorials/flexbox/quick/ http://www.css3.info/preview/multi-column-layout/ http://msdn.microsoft.com/en-us/library/ie/hh673558(v=vs.85).aspx http://dev.w3.org/csswg/css3-grid-layout/ http://dev.w3.org/csswg/css3-regions/   Create an animated and adaptive UI. o This objective may include but is not limited to: animate objects by applying CSS transitions; apply 3-D and 2-D transformations; adjust UI based on media queries (device adaptations for output formats, displays, and representations); hide or disable controls http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/   Find elements by using CSS selectors and jQuery. o This objective may include but is not limited to: choose the correct selector to reference an element; define element, style, and attribute selectors; find elements by using pseudo-elements and pseudo-classes (for example, :before, :first-line, :first-letter, :target, :lang, :checked, :first-child) http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/   Structure a CSS file by using CSS selectors. o This objective may include but is not limited to: reference elements correctly; implement inheritance; override inheritance by using !important; style an element based on pseudo-elements and pseudo-classes (for example, :before, :first-line, :first-letter, :target, :lang, :checked, :first-child) http://www.bloggedbychris.com/2012/09/19/microsoft-exam-70-480-study-guide/   Technorati Tags: 70-480,CSS3,HTML5,HTML,CSS,JavaScript,Certification

    Read the article

  • Tween Animation Cannot Start

    - by David Dimalanta
    Do you have any reasons why my tween code didn't run or work? I already add the tween engine onto the library folder under LibGDX project folder and "Order and Export" it under Java Build Path at the Properties menu. My first two classes ran correctly and workly but my third class didn't work. Here's the sequence: First class is the first screen. Fade animation works on the company's logo. Second class is the second screen. Fade animation for the loading screen works. Third class is the third screen. After the second screen, now calls for the third screen. Animation stopped or won't run since I want the black screen to fade out at the start when the menu is here. Can you check if I did right? Look carefully by comment lines for explanation. //-----[ Animation Setup ]----- Tween.registerAccessor(Sprite.class, new Tween_Animation()); // --> Tween_Animation.java Tween_Manager = new TweenManager(); // --> I initialized it the TweenManager and seems okay. cb_start = new TweenCallback() // --> I'll use this when I choose START and the menu will fade in black. { @Override public void onEvent(int arg0, BaseTween<?> arg1) { goTo(); } }; Tween // --> This is where I focused the problem. .to(black_Sprite, Tween_Animation.ALPHA, 3f) .target(1) .ease(TweenEquations.easeInQuad) .repeatYoyo(200, 2.5f) // --> I set the repeat for 200 times when I noticed that the animation won't work! .start(Tween_Manager);

    Read the article

  • September 2012 Release of the Ajax Control Toolkit

    - by Stephen.Walther
    I’m excited to announce the September 2012 release of the Ajax Control Toolkit! This is the first release of the Ajax Control Toolkit which supports the .NET 4.5 framework. We also continue to support ASP.NET 3.5 and ASP.NET 4.0. With this release, we’ve made several important bug fixes. The Superexpert team focused on fixing the highest voted issues associated with the CascadingDropDown control. I’ve created a list of these bug fixes later in this blog post. You can download the latest release of the Ajax Control Toolkit by visiting the following page at CodePlex: http://AjaxControlToolkit.CodePlex.com Alternatively, you can install the latest version of the Ajax Control Toolkit using NuGet by firing off the following command from the Package Manager Console: Install-Package AjaxControlToolkit Using the Ajax Control Toolkit with ASP.NET 4.5 Let me walk through the steps for using the Ajax Control Toolkit with ASP.NET 4.5. First, I’ll create a new ASP.NET 4.5 website with Visual Studio 2012. I’ll create the new website with the ASP.NET Web Forms Application template: When you create a new ASP.NET 4.5 site with the ASP.NET Web Forms Application template, you get a starter website. If you run the site, then you get a page with default content: Let me show you how you can add the Ajax Control Toolkit Calendar control to the homepage of this starter site. The first step is to use NuGet to install the Ajax Control Toolkit. Right-click the References folder in the Solution Explorer window and select the menu option Manage NuGet Packages. In the Manage NuGet Packages dialog, use the search box to search for the Ajax Control Toolkit (enter “AjaxControlToolkit”). After you find it, click the Install button to add the Ajax Control Toolkit to your project. That’s all you have to do to install the Ajax Control Toolkit! Now we are ready to start using the Ajax Control Toolkit controls. Open the default.aspx page so we can modify the contents of the page. Erase everything contained in the Content control with the ID of BodyContent. After erasing the content, declare the following two controls: <asp:TextBox ID="vacationDate" runat="server" /> <ajaxToolkit:CalendarExtender TargetControlID="vacationDate" runat="server" /> The first control is a standard ASP.NET TextBox control and the second control is an Ajax Control Toolkit Calendar control. You should get intellisense as you type out the Ajax Control Toolkit Calendar control. If you don’t, then close and re-open the Default.aspx page. Now, let’s run our app. Hit the F5 button or select Debug, Start Debugging from the Visual Studio menu. You will get the error message “MsAjaxBundle is not a valid script name”. Don’t despair! We need to update the Master Page so it uses the ToolkitScriptManager instead of the default ScriptManager. Open the Site.Master file and find where the ScriptManager is declared. The ScriptManager should look like this: <asp:ScriptManager runat="server"> <Scripts> <%--Framework Scripts--%> <asp:ScriptReference Name="MsAjaxBundle" /> <asp:ScriptReference Name="jquery" /> <asp:ScriptReference Name="jquery.ui.combined" /> <asp:ScriptReference Name="WebForms.js" Assembly="System.Web" Path="~/Scripts/WebForms/WebForms.js" /> <asp:ScriptReference Name="WebUIValidation.js" Assembly="System.Web" Path="~/Scripts/WebForms/WebUIValidation.js" /> <asp:ScriptReference Name="MenuStandards.js" Assembly="System.Web" Path="~/Scripts/WebForms/MenuStandards.js" /> <asp:ScriptReference Name="GridView.js" Assembly="System.Web" Path="~/Scripts/WebForms/GridView.js" /> <asp:ScriptReference Name="DetailsView.js" Assembly="System.Web" Path="~/Scripts/WebForms/DetailsView.js" /> <asp:ScriptReference Name="TreeView.js" Assembly="System.Web" Path="~/Scripts/WebForms/TreeView.js" /> <asp:ScriptReference Name="WebParts.js" Assembly="System.Web" Path="~/Scripts/WebForms/WebParts.js" /> <asp:ScriptReference Name="Focus.js" Assembly="System.Web" Path="~/Scripts/WebForms/Focus.js" /> <asp:ScriptReference Name="WebFormsBundle" /> <%--Site Scripts--%> </Scripts> </asp:ScriptManager> We need to make three changes to the ScriptManager: 1) We need to replace the asp:ScriptManager with the ajaxToolkit:ToolkitScriptManager 2) We need to remove the MsAjaxBundle bundle from the ScriptReferences 3) We need to remove the Assembly=”System.Web” attributes from the ScriptReferences After you make these three changes, the ToolkitScriptManager should looks like this: <ajaxToolkit:ToolkitScriptManager runat="server"> <Scripts> <%--Framework Scripts--%> <asp:ScriptReference Name="jquery" /> <asp:ScriptReference Name="jquery.ui.combined" /> <asp:ScriptReference Name="WebForms.js" Path="~/Scripts/WebForms/WebForms.js" /> <asp:ScriptReference Name="WebUIValidation.js" Path="~/Scripts/WebForms/WebUIValidation.js" /> <asp:ScriptReference Name="MenuStandards.js" Path="~/Scripts/WebForms/MenuStandards.js" /> <asp:ScriptReference Name="GridView.js" Path="~/Scripts/WebForms/GridView.js" /> <asp:ScriptReference Name="DetailsView.js" Path="~/Scripts/WebForms/DetailsView.js" /> <asp:ScriptReference Name="TreeView.js" Path="~/Scripts/WebForms/TreeView.js" /> <asp:ScriptReference Name="WebParts.js" Path="~/Scripts/WebForms/WebParts.js" /> <asp:ScriptReference Name="Focus.js" Path="~/Scripts/WebForms/Focus.js" /> <asp:ScriptReference Name="WebFormsBundle" /> <%--Site Scripts--%> </Scripts> </ajaxToolkit:ToolkitScriptManager> After we make these changes, the app should run successfully. You’ll get a page which contains a text field. When you click inside the text field, a popup calendar is displayed. Ajax Control Toolkit and jQuery You might have noticed that the ScriptManager includes a reference to jQuery by default. We did not remove that reference when we converted the ScriptManager to a ToolkitScriptManager. You can use the Ajax Control Toolkit and jQuery side-by-side. Here’s how you can modify the Default.aspx page so that it contains two popup calendars. The first popup calendar is created with the Ajax Control Toolkit and the second popup calendar is created with jQuery: <asp:TextBox ID="vacationDate" runat="server" /> <ajaxToolkit:CalendarExtender TargetControlID="vacationDate" runat="server" /> <input id="birthDate" /> <script> $("#birthDate").datepicker(); </script> Before you can start using jQuery UI plugins, you need to complete one more step. You need to add the jQuery UI themes bundle to the HEAD of the Site.Master page like this: <head runat="server"> <meta charset="utf-8" /> <title><%: Page.Title %> - My ASP.NET Application</title> <asp:PlaceHolder runat="server"> <%: Scripts.Render("~/bundles/modernizr") %> </asp:PlaceHolder> <webopt:BundleReference runat="server" Path="~/Content/css" /> <webopt:BundleReference runat="server" Path="~/Content/themes/base/css" /> <link href="~/favicon.ico" rel="shortcut icon" type="image/x-icon" /> <meta name="viewport" content="width=device-width" /> <asp:ContentPlaceHolder runat="server" ID="HeadContent" /> </head> The markup above includes a reference to the jQuery UI themes bundle: <webopt:BundleReference runat="server" Path="~/Content/themes/base/css" /> Now that we have made these changes, we can use the Ajax Control Toolkit and jQuery at the same time. When you run your app, you get two popup calendars. When you click in the first text field, the Ajax Control Toolkit calendar appears. When you click in the second text field, the jQuery UI popup calendar appears: Bug Fixes in this Release We made several important bug fixes with this release of the Ajax Control Toolkit and integrated several Pull Requests contributed by the community. Our primary focus during this sprint was fixing issues with the CascadingDropDown control. We fixed the following issues associated with the CascadingDropDown: · 9490 – Don’t disable dropdowns in CascadingDropDown · 14223 – CascadingDropDown Reset or Setting SelectedValue from WebMethod · 12189 – CascadingDropDown not obeying disabled state of DropDownList · 22942 – CascadingDropDown infinite loop (with solution) · 8671 – CascadingDropdown options is null or undefined · 14407 – CascadingDropDown: populated client event happens too often · 17148 – CascadingDropDown – Add “UseHttpGet” property · 10221 – No NotNull check in CascadingDropDown · 12228 – Provide property for case-insensitive DefaultValue lookup in CascadingDropdown We also fixed the following two issues which are not directly related to the CascadingDropDown control: · 27108 – CalendarExtender: Bug when selecting December shifts to January. · 27041 – Input controls with HTML5 types do not post back in Firefox, Chrome, Safari Finally, we integrated several Pull Requests submitted by the community (Thank you community!): · Added French localized resources for the AjaxFileUpload · Resolved an issue which prevented the AjaxFileUpload control from working with pages that require query string variables. · Extended the AjaxFileUploadEventArgs class to include the current file index in the queue and the total number of files in the queue. · Fixed an issue with TabContainer and TabPanel which caused the OnActiveTabChanged event to fire too often. Summary I’m happy to see the Ajax Control Toolkit move forward into the brave new world of ASP.NET 4.5! In this latest release, we focused on ensuring that the Ajax Control Toolkit works smoothly with ASP.NET 4.5 applications. We also fixed the highest voted bugs associated with the CascadingDropDown control and integrated several Pull Request submitted by the community. Once again, I want to thank the Superexpert team for their hard work on this release!

    Read the article

< Previous Page | 115 116 117 118 119 120 121 122 123 124 125 126  | Next Page >