Search Results

Search found 554 results on 23 pages for 'amit singh'.

Page 12/23 | < Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >

  • How can we call an activity through service in android???

    - by Shalini Singh
    Hi! friends, i am a android developer,,, want to know is it possible to call an activity through background service in android like : import android.app.Service; import android.content.Intent; import android.content.SharedPreferences; import android.media.MediaPlayer; import android.os.Handler; import android.os.IBinder; import android.os.Message; public class background extends Service{ private int timer1; @Override public void onCreate() { // TODO Auto-generated method stub super.onCreate(); SharedPreferences preferences = getSharedPreferences("SaveTime", MODE_PRIVATE); timer1 = preferences.getInt("time", 0); startservice(); } @Override public IBinder onBind(Intent arg0) { // TODO Auto-generated method stub return null; } private void startservice() { Handler handler = new Handler(); handler.postDelayed(new Runnable(){ public void run() { mediaPlayerPlay.sendEmptyMessage(0); } }, timer1*60*1000); } private Handler mediaPlayerPlay = new Handler(){ @Override public void handleMessage(Message msg) { try { getApplication(); MediaPlayer mp = new MediaPlayer(); mp = MediaPlayer.create(background.this, R.raw.alarm); mp.start(); } catch(Exception e) { e.printStackTrace(); } super.handleMessage(msg); } }; /* * (non-Javadoc) * * @see android.app.Service#onDestroy() */ @Override public void onDestroy() { // TODO Auto-generated method stub super.onDestroy(); } } i want to call my activity......

    Read the article

  • start to preload content after a complete page load

    - by amit
    i am trying to make the preloading work in such a way that the components i wish to preload start to load after successfully loading the page. for example, i have index.php. i want it to load up completely. as soon as it loads up i want to start loading the other components. to make things clear. i have a nav that makes use of large size images. if i load them along with the index.php file, it would increase load up time of the page. i wish for those large images to load after completely rendering index.php? am i making sense? is it possible?

    Read the article

  • UIImage resize and crop to fit

    - by Amit Hagin
    I read a lot, also here, but couldn't find a simple way to do it: In objective c - I have a big UIImage and a small UIImageView. I want to programmatically shrink the content of a UIImage just enough to fit the smaller dimension within the UIImageView. The larger dimension will be cropped, and the result will be the maximum I can get from an image without changing the proportion. can you please help me?

    Read the article

  • Getting custom attribute from an Exception thrown during testing

    - by Amit Bhargava
    I'm using JUnit4 to test my code. Now, I'm aware that the following annotation allows me to expect an exception of a certain type @Test(expected = NipException.class) However, I have an 'errorCode' property in my exception class which I would also like to verify. This is because the same exception is thrown at three places in the same method with different error codes. How do I access 'errorCode' of the thrown exception?

    Read the article

  • Issues while downloading document from Sharepoint using JAVA

    - by Deepak Singh Rawat
    I am trying to download a file from Sharepoint 2007 sp2 document library using GetItem method of the Copy webservice. I am facing the following issues : In the local instance ( Windows Vista ) I can save only 10.5 Kb of any file. The webservice is returning only 10.5 Kb of data for any file. On the production server, I am able to List the documents using some credentials but when I am trying to download a document using the same credentials I get a 401 : Unauthorized message. I can download the document using the Sharepoint website successfully.

    Read the article

  • Response.Redirect() will not redirect on Internet Explorer

    - by Amit
    Hi, I am using Response.Redirect("someurl",true); in the page_preInit event to redirect all the requests that come to a page. It works fine on Firexox, but if i access the page from internet explorer 7/8, it says page can not be found and will not redirect to new URL. Any idea why this happens?? Update: I tried giving a radom URL in the redirect such as google.com and it works fine. Actually the URL I am trying to redirect is not accessible on my machine, it is on another VPN. I guess IE will not change the URL on the addressbar if it can not access the URL. Firefox on the other hand changes the address on the address bar.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Application crashing on getting updated information from database using timer and storing it on loca

    - by Amit Battan
    In our multi - user application we are continuously interacting with database. We have a common class through which we are sending POST queries to database and obtaining xml files in return. We are using delegates of NSXMLParser to parse the obtained file. The problem with us is we are facing many crashes in it generally when application is idle and changed data in database is being fetched in background through timer which is invoked after every few seconds. We have also dealt with error handling through try and catch but it proves to be of no use in this case and mostly application crashes with following error : Exception Type: EXC_BAD_ACCESS (SIGBUS) Exception Codes: KERN_PROTECTION_FAILURE at 0x0000000000000020 Strange thing is that many times the fetching of updated data at background works very fine, same methods being successfully executed under similar conditions but suddenly it crashes on one of them. The codes we are using is as follows: // we are using timer in this way: chkOnlineUser=[NSTimer scheduledTimerWithTimeInterval:15 target:mmObject selector:@selector(threadOnlineUser) userInfo:NULL repeats:YES]; // this method being called in timer -(void)threadOnlineUser{//HeartBeat in Thread [NSThread detachNewThreadSelector:@selector(onlineUserRefresh) toTarget:self withObject:nil]; } // this performs actual updation -(void)onlineUserRefresh{ NSAutoreleasePool *pool =[[NSAutoreleasePool alloc]init]; @try{ if(chkTimer==1){ return; } chkTimer=1; if([allUserArray count]==0){ [user parseXMLFileUser:@"all" andFlag:3]; [allUserArray removeAllObjects]; [allUserArray addObjectsFromArray:[user users]]; } [objHeartBeat parseXMLFile:[loginID intValue] timeOut:10]; NSMutableDictionary *tDictOL=[[NSMutableDictionary alloc] init]; tDictOL=[objHeartBeat onLineList]; NSArray *tArray=[[NSArray alloc] init]; tArray=[[tDictOL objectForKey:@"onlineuser"] componentsSeparatedByString:@","]; [loginUserArray removeAllObjects]; for(int l=0;l less than [tArray count] ;l++){ int t;//=[[tArray objectAtIndex:l] intValue]; if([[allUserArray valueForKey:@"Id"] containsObject:[tArray objectAtIndex:l]]){ t = [[allUserArray valueForKey:@"Id"] indexOfObject:[tArray objectAtIndex:l]]; [loginUserArray addObject:[allUserArray objectAtIndex:t]]; } } [onlineTable reloadData]; [logInUserPopUp removeAllItems]; if([loginUserArray count]==1){ [labelLoginUser setStringValue:@"Only you are online"]; [logInUserPopUp setEnabled:YES]; }else{ [labelLoginUser setStringValue:[NSString stringWithFormat:@" %d users online",[loginUserArray count]]]; [logInUserPopUp setEnabled:YES]; } NSMenu *menu = [[NSMenu alloc] initWithTitle:@"menu"]; NSMenuItem *itemOne = [[NSMenuItem alloc] initWithTitle:@"" action:NULL keyEquivalent:@""]; [menu addItem:itemOne]; for(int l=0;l less than [loginUserArray count];l++){ NSString *tempStr= [NSString stringWithFormat:@"%@ %@",[[[loginUserArray objectAtIndex:l] objectForKey:@"user_fname"] stringByTrimmingCharactersInSet:[NSCharacterSet whitespaceAndNewlineCharacterSet]],[[[loginUserArray objectAtIndex:l] objectForKey:@"user_lname"] stringByTrimmingCharactersInSet:[NSCharacterSet whitespaceAndNewlineCharacterSet]]]; if(![tempStr isEqualToString:@""]){ NSMenuItem *itemOne = [[NSMenuItem alloc] initWithTitle:tempStr action:NULL keyEquivalent:@""]; [menu addItem:itemOne]; }else if(l==0){ NSMenuItem *itemOne = [[NSMenuItem alloc] initWithTitle:tempStr action:NULL keyEquivalent:@""]; [menu addItem:itemOne]; } } [logInUserPopUp setMenu:menu]; if([lastUpdateTime isEqualToString:@""]){ }else { [self fetchUpdatedInfo:lastUpdateTime]; [self fetchUpdatedGroup:lastUpdateTime];// function same as fetchUpdatedInfo [avObject fetchUpdatedInfo:lastUpdateTime];// function same as fetchUpdatedInfo [esTVObject fetchUpdatedInfo:lastUpdateTime];// function same as fetchUpdatedInfo } lastUpdateTime=[[tDictOL objectForKey:@"lastServerTime"] copy]; } @catch (NSException * e) { [queryByPost insertException:@"MainModule" inFun:@"onlineUserRefresh" excp:[e description] userId:[loginID intValue]]; NSRunAlertPanel(@"Error Panel", @"Main Module- onlineUserRefresh....%@", @"OK", nil, nil,e); } @finally { NSLog(@"Internal Update Before Bye"); chkTimer=0; NSLog(@"Internal Update Bye");// Some time application crashes after this log // Some time application crahses after "Internal Update Bye" log } } // The method which we are using to obtain updated data is of following form: -(void)fetchUpdatedInfo:(NSString *)UpdTime{ @try { if(initAfterLoginComplete==0){ return; } [user parseXMLFileUser:UpdTime andFlag:[loginID intValue]]; [tempUserUpdatedArray removeAllObjects]; [tempUserUpdatedArray addObjectsFromArray:[user users]]; if([tempUserUpdatedArray count]0){ if([contactsView isHidden]){ [topContactImg setImage:[NSImage imageNamed:@"btn_contacts_off_red.png"]]; }else { [topContactImg setImage:[NSImage imageNamed:@"btn_contacts_red.png"]]; } }else { return; } int chkprof=0; for(int l=0;l less than [tempUserUpdatedArray count];l++){ NSArray *tempArr1 = [allUserArray valueForKey:@"Id"]; int s; if([[[tempUserUpdatedArray objectAtIndex:l] objectForKey:@"Id"] intValue]==profile_Id){ chkprof=1; } if([tempArr1 containsObject:[[tempUserUpdatedArray objectAtIndex:l] objectForKey:@"Id"]]){ s = [tempArr1 indexOfObject:[[tempUserUpdatedArray objectAtIndex:l] objectForKey:@"Id"]]; [allUserArray replaceObjectAtIndex:s withObject:[tempUserUpdatedArray objectAtIndex:l]]; }else { [allUserArray addObject:[tempUserUpdatedArray objectAtIndex:l]]; } NSArray *tempArr2 = [tempUser valueForKey:@"Id"]; if([tempArr2 containsObject:[[tempUserUpdatedArray objectAtIndex:l] objectForKey:@"Id"]]){ s = [tempArr2 indexOfObject:[[tempUserUpdatedArray objectAtIndex:l] objectForKey:@"Id"]]; [tempUser replaceObjectAtIndex:s withObject:[tempUserUpdatedArray objectAtIndex:l]]; }else { [tempUser addObject:[tempUserUpdatedArray objectAtIndex:l]]; } } NSSortDescriptor *sortDescriptor = [[NSSortDescriptor alloc] initWithKey:@"user_fname" ascending:YES]; [tempUser sortUsingDescriptors:[NSMutableArray arrayWithObject:sortDescriptor]]; [userListTableView reloadData]; [groupsArray removeAllObjects]; for(int z=0;z less than [tempGroups count];z++){ NSMutableArray *tempMArr=[[NSMutableArray alloc] init]; for(int l=0;l less than [allUserArray count];l++){ if([[[allUserArray objectAtIndex:l] objectForKey:@"GroupId"] intValue]==[[[tempGroups objectAtIndex:z] objectForKey:@"group_id"] intValue]){ [tempMArr addObject:[allUserArray objectAtIndex:l]]; } } [groupsArray insertObject:tempMArr atIndex:z]; [tempMArr release]; tempMArr= nil; } for(int n=0;n less than [tempGroups count];n++){ [[groupsArray objectAtIndex:n] addObject:[tempGroups objectAtIndex:n]]; } [groupsListOV reloadData]; if(chkprof==1){ [self profileShow:profile_Id]; }else { } [self selectUserInTable:0]; }@catch (NSException * e) { NSRunAlertPanel(@"Error Panel", @"%@", @"OK", nil, nil,e); } } // The method which we are using to frame select query and parse obtained data is: -(void)parseXMLForUser:(int)UId stringVar:(NSString*)stringVar{ @try{ if(queryByPost) [queryByPost release]; queryByPost=[QueryByPost new]; // common class used to invoke method to send request via POST method //obtaining data for xml parsing NSString *query=[NSString stringWithFormat:@"Select * from userinfo update_time = '%@' AND NOT owner_id ='%d' ",stringVar,UId]; NSData *obtainedData=[queryByPost executeQuery:query WithAction:@"query"]; // method invoked to perform post query if(obtainedData==nil){ // data not obtained so return return; } // initializing dictionary to be obtained after parsing if(obtainedDictionary) [obtainedDictionary release]; obtainedDictionary=[NSMutableDictionary new]; // xml parsing if (updatedDataParser) // airportsListParser is an NSXMLParser instance variable [updatedDataParser release]; updatedDataParser = [[NSXMLParser alloc] initWithData:obtainedData]; [updatedDataParser setDelegate:self]; [updatedDataParser setShouldResolveExternalEntities:YES]; BOOL success = [updatedDataParser parse]; } @catch (NSException *e) { NSLog(@"wtihin parseXMLForUser- parseXMLForUser:stringVar: - %@",[e description]); } } //The method which will attempt to interact 4 times with server if interaction with it is found to be unsuccessful , is of following form: -(NSData*)executeQuery:(NSString*)query WithAction:(NSString*)doAction{ NSLog(@"within ExecuteQuery:WithAction: Query is: %@ and Action is: %@",query,doAction); NSString *returnResult; @try { NSString *returnResult; NSMutableURLRequest *postRequest; NSError *error; NSData *searchData; NSHTTPURLResponse *response; postRequest=[self directMySQLQuery:query WithAction:doAction]; // this method sends actual POST request NSLog(@"after directMYSQL in QueryByPost- performQuery... ErrorLogMsg"); searchData = [NSURLConnection sendSynchronousRequest:postRequest returningResponse:&response error:&error]; returnResult = [[NSString alloc] initWithData:searchData encoding:NSASCIIStringEncoding]; NSString *resultToBeCompared=[returnResult stringByTrimmingCharactersInSet:[NSCharacterSet whitespaceAndNewlineCharacterSet]]; NSLog(@"result obtained - %@/ resultToBeCompared - %@",returnResult,resultToBeCompared); if(![resultToBeCompared isEqualToString:@""]){ }else { sleep(10); postRequest=[self directMySQLQuery:query WithAction:doAction]; searchData = [NSURLConnection sendSynchronousRequest:postRequest returningResponse:&response error:&error]; if(![resultToBeCompared isEqualToString:@""]){ }else { sleep(10); postRequest=[self directMySQLQuery:query WithAction:doAction]; searchData = [NSURLConnection sendSynchronousRequest:postRequest returningResponse:&response error:&error]; if(![resultToBeCompared isEqualToString:@""]){ }else { sleep(10); postRequest=[self directMySQLQuery:query WithAction:doAction]; searchData = [NSURLConnection sendSynchronousRequest:postRequest returningResponse:&response error:&error]; if(![resultToBeCompared isEqualToString:@""]){ }else { sleep(10); postRequest=[self directMySQLQuery:query WithAction:doAction]; searchData = [NSURLConnection sendSynchronousRequest:postRequest returningResponse:&response error:&error]; if(![resultToBeCompared isEqualToString:@""]){ }else { return nil; } } } } } returnResult = [[NSString alloc] initWithData:searchData encoding:NSASCIIStringEncoding]; return searchData; } @catch (NSException * e) { NSLog(@"within QueryByPost , execurteQuery:WithAction - %@",[e description]); return nil; } } // The method which sends POST request to server , is of following form: -(NSMutableURLRequest *)directMySQLQuery:(NSString*)query WithAction:(NSString*)doAction{ @try{ NSLog(@"Query is: %@ and Action is: %@",query,doAction); // some pre initialization NSString *stringBoundary,*contentType; NSURL *cgiUrl ; NSMutableURLRequest *postRequest; NSMutableData *postBody; NSString *ans=@"434"; cgiUrl = [NSURL URLWithString:@"http://keysoftwareservices.com/API.php"]; postRequest = [NSMutableURLRequest requestWithURL:cgiUrl]; [postRequest setHTTPMethod:@"POST"]; stringBoundary = [NSString stringWithString:@"0000ABCQueryxxxxxx"]; contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@", stringBoundary]; [postRequest addValue:contentType forHTTPHeaderField: @"Content-Type"]; //setting up the body: postBody = [NSMutableData data]; [postBody appendData:[[NSString stringWithFormat:@"\r\n\r\n--%@\r\n",stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"code\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:ans] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"action\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:doAction] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"devmode\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:[[[NSBundle mainBundle] infoDictionary] objectForKey:@"devmode"]] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"q\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:query] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postRequest setHTTPBody:postBody]; NSLog(@"Direct My SQL ok");// Some time application crashes afte this log //Some time application crashes after "Direct My SQL ok" log return [postRequest mutableCopy]; }@catch (NSException * e) { NSLog(@"NSException %@",e); NSRunAlertPanel(@"Error Panel", @"Within QueryByPost- directMySQLQuery...%@", @"OK", nil, nil,e); return nil; } }

    Read the article

  • php POST response

    - by amit
    I am making a POST to another php file that I want to render in the browser. so clearly, using jquery POST wont work, since it works through AJAX. echo '<div class="showcase_URL"><a class="purl" name="'.$row->num.'" href="#">PROJECT URL</a></div>'; what I have till now in javascript is: $(".showcase_URL a").click(function() { //alert($(this).attr("name")); var number = $(this).attr("name"); $.post( "app-display.php", {app: number}, function(data){ top.location.href = 'app-display.php'; }); }); what I have in app-display.php: $query = 'SELECT num, title, thumb_url, url, type, cat, dated, details FROM app WHERE `num` = "$_POST[app]"'; but it is currently giving me a page without the contents of app-display.php. all the other fragments of the page are loading: header, footer etc. the PHP Response (in Firebug) I am getting is the normal html of the page. how should i do it?

    Read the article

  • calling background service from BroadcastReceiver....

    - by Shalini Singh
    Hi , i am trying to call a push notification background from BroadcastReceiver class.but my application is going to crash the code is given bellow public class AlarmReceiver extends BroadcastReceiver { Context ctx; static int count=1; @Override public void onReceive(Context context, Intent intent) { // TODO Auto-generated method stub //Toast.makeText(context, "working"+count, Toast.LENGTH_LONG).show(); count++; Log.e("broadcast***","receiver"); Intent myIntent=new Intent(context,NotifyService.class); myIntent.setFlags(Intent.FLAG_ACTIVITY_NEW_TASK); context.startActivity(myIntent); } } * manifest entry:- <intent-filter> <action android:name="android.intent.action.BOOT_COMPLETED"/> </intent-filter> </receiver> Error: 05-24 15:17:00.042: ERROR/AndroidRuntime(424): Caused by: android.content.ActivityNotFoundException: Unable to find explicit activity class {com.android.alarm/com.android.alarm.NotifyService}; have you declared this activity in your AndroidManifest.xml? Please help me....

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Source control on internet i.e. no private networks.

    - by Kavitesh Singh
    Me and my friend are in the process of starting a small project and want to implement a source control. Now both are located in different cities and can communicate using internet for file sharing etc. I need an online hosting solution or any way where i can maintain the source code repository for both of us to check in/out. As of now we want to maintain it as private project. Does sourceforge allow hosting projects which would not be opensource? One option i was thinking, to obtain a static IP form ISP and host the repository.But that mean my system needs to be online when my friend wants to checkin/out or do some diff with old version code. Secondly, would SVN or git be a better choice in such a situation. I have no experience in git/mercurial as of now.

    Read the article

  • select option in Safari ?

    - by Karandeep Singh
    < select size="2" multiple> < option value="1">1< /option> < option value="2">2< /option> < option value="3">3< /option> < option value="4">4< /option> < option value="5">5< /option> < option value="6">6< /option> < option value="7">7< /option> < option value="8">8< /option> < option value="9">9< /option> < option value="10">10< /option> < option value="11">11< /option> < option value="12">12< /option> < option value="13">13< /option> < /select> size attribute of Select tag is not working properly in Safari. if size attribute's value is greater than four then there have no problem, its working. But when I set the value of size less than four then it show four values. above example displays four options in safari but I want two options. What is the reason for this ?

    Read the article

  • how to get NSTextField in custom NSFormatter class

    - by Amit
    i am new to cocoa and objective-c and creating small application having few NStextFields on the window.I have create custom NSformatter to validate the inputs,at some instance i want to get the NStextField within my custom NSformatter to change its backcolor to red to notify user for wrong input value.I didn't getting how to get the currently selected/focused NStextfield for which i want to change backcolor.

    Read the article

  • jQuery - events won't fire for dynamically created tab elements..

    - by Amit
    Hi, I am using jQuery UI Tabs. <div id="tabs"> <ul id="tablist"> <li><a href="#fragment-1"><span>One</span></a></li> </ul> </div> I have a button that adds new tabs. I use the following code: var newTabId = $('#tabs').tabs('option', 'selected') + 1; $('#tabs').tabs("add",'someUrl.htm','New Tab',newTabId); (Tab will be added next to the currently selected tab) Now none of the newly added tabs fire any events such as a click or hover $('#tablist li').click(function(){ alert('test message'); }); But events fire properly for the tabs that were there in the initial source code. How to resolve?

    Read the article

  • Solving the water jug problem

    - by Amit
    While reading through some lecture notes on preliminary number theory, I came across the solution to water jug problem (with two jugs) which is summed as thus: Using the property of the G.C.D of two numbers that GCD(a,b) is the smallest possible linear combination of a and b, and hence a certain quantity Q is only measurable by the 2 jugs, iff Q is a n*GCD(a,b), since Q=sA + tB, where: n = a positive integer A = capacity of jug A B= capacity of jug B And, then the method to the solution is discussed Another model of the solution is to model the various states as a state-space search problem as often resorted to in Artificial Intelligence. My question is: What other known methods exist which models the solution, and how? Google didn't throw up much.

    Read the article

  • how to get the value from a CSS class object in javascript

    - by amit
    I have to select an <a> element from the given class of objects. when i click on the anchor tag in the showcase_URL class, i want the jquery function to get the value from <a> tag. How can this be done? I cannot make this an id as I am running a while loop to construct all the elements in php. there would be multiple objects of this class. there is no definite selector through which I can get the value of the anchor tag. Help would be much appreciated. echo '<div id="content">'; echo '<div class="showcase_data">'; echo '<div class="showcase_HEAD">'.$row->title.'</div>'; echo '<div class="showcase_TYPE">'.$row->type.'</div>'; echo '<div class="showcase_date">&nbsp;&nbsp;'.$row->date.'</div>'; echo '<div class="showcase_THUMB" style="float: left;" ></div>'; echo '<div class="showcase_TEXT">'.$row->details.'</div><br/>'; echo '<div class="showcase_URL"><a class="purl" value='.$row->num.'href="'.$row->url.'">PROJECT URL</a></div>'; echo '</div>'; echo '</div>';

    Read the article

  • Brackets matching using BIT

    - by amit.codename13
    edit: I was trying to solve a spoj problem. Here is the link to the problem : http://spoj.pl/problems/BRCKTS I can think of two possible data structures for solving the problem one using segment tree and the other using a BIT. I have already implemented the solution using a segment tree. I have read about BIT but i can't figure out how to do a particular thing with it(which i have mentioned below) I am trying to check if brackets are balanced in a given string containing only ('s or )'s. I am using a BIT(Binary indexed tree) for solving the problem. The procedure i am following is as follows: I am taking an array of size equal to the number of characters in the string. I am assigning -1 for ) and 1 for ( to the corresponding array elements. Brackets are balanced in the string only if the following two conditions are true. The cumulative sum of the whole array is zero. Minimum cumulative sum is non negative. i.e the minimum of cumulative sums of all the prefixes of the array is non-negative. Checking condition 1 using a BIT is trivial. I am facing problem in checking condition 2.

    Read the article

  • How to edit javascript in browser?

    - by Amit
    Hi I was looking for a way to edit javascript in browser such as firefox on the fly and execute it. Firebug allows us to edit html and css on the fly but javascript is a pain.... i have to go back to the source and modify that.. Is there a way to do it?

    Read the article

  • make desktop sms application using blackberry

    - by Amit Kumar Jha
    hey all, I have to make a SMS sending application in .NET, which uses the attached Blackberry handset(blackberry tour 9630 to be precise) to send SMS. I have never worked on smartphone application development, so want help in doing this. I searched SO for an answer and found one question, but its in java and i think that code would run on blackberry itself and not on desktop, correct me if i am wrong. So if someone could point me in the right direction I would be very grateful. Thanks in advance to all those who reply.

    Read the article

< Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >