Search Results

Search found 518 results on 21 pages for 'brij raj singh'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 12/21 | < Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >

  • How to set an Image fit to width of ScrollViewer

    - by Raj
    I've Image placed inside a ScrollViewer. <ScrollViewer x:Name="imageScroller" Grid.Column="2" Margin="5" HorizontalScrollBarVisibility="Visible" VerticalScrollBarVisibility="Visible"> <Image x:Name="imageViewer" Cursor="Hand" RenderTransformOrigin="0,0" Margin="0"> <Image.LayoutTransform> <ScaleTransform ScaleX="{Binding Path=Zoom, Converter={StaticResource debugConverter}}" ScaleY="{Binding Path=Zoom, Converter={StaticResource debugConverter}}"/> </Image.LayoutTransform> </Image> </ScrollViewer> How do I zoom image like "fit-to-width" in document viewers to the size and height of ScrollViewer?

    Read the article

  • Index Tuning for SSIS tasks

    - by Raj More
    I am loading tables in my warehouse using SSIS. Since my SSIS is slow, it seemed like a great idea to build indexes on the tables. There are no primary keys (and therefore, foreign keys), indexes (clustered or otherwise), constraints, on this warehouse. In other words, it is 100% efficiency free. We are going to put indexes based on usage - by analyzing new queries and current query performance. So, instead of doing it our old fashioned sweat and grunt way of actually reading the SQL statements and execution plans, I thought I'd put the shiny new Database Engine Tuning Advisor to use. I turned SQL logging off in my SSIS package and ran a "Tuning" trace, saved it to a table and analyzed the output in the Tuning Advisor. Most of the lookups are done as: exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',1 exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',2 exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',3 exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',4 and when analyzed, these statements have the reason "Event does not reference any tables". Huh? Does it not see the FROM dbo.Company??!! What is going on here? So, I have multiple questions: How do I get it to capture the actual statement executing in my trace, not what was submitted in a batch? Are there any best practices to follow for tuning performance related to SSIS packages running against SQL Server 2008?

    Read the article

  • Source control on internet i.e. no private networks.

    - by Kavitesh Singh
    Me and my friend are in the process of starting a small project and want to implement a source control. Now both are located in different cities and can communicate using internet for file sharing etc. I need an online hosting solution or any way where i can maintain the source code repository for both of us to check in/out. As of now we want to maintain it as private project. Does sourceforge allow hosting projects which would not be opensource? One option i was thinking, to obtain a static IP form ISP and host the repository.But that mean my system needs to be online when my friend wants to checkin/out or do some diff with old version code. Secondly, would SVN or git be a better choice in such a situation. I have no experience in git/mercurial as of now.

    Read the article

  • What is the difference between clearcase and vss in label a release?

    - by raj
    Hi, We are using clearcase as our SCM. I have not much experience with clearcase. Now we are about to release our code to production. I want to label my code as I have done using VSS in my previous projects. But in clearcase labeling is not as easy as in VSS. clearcase is asking to create a label type before label a folder in VOB. I don't understand the concept of creating label type? Any guidance on this will be highly appreciated.

    Read the article

  • How to extract the data from data.store to an array?

    - by Prateek Raj
    Hi everyone, i have the class var prstore = new Ext.data.Store({ url: 'xmlformat.xml', autoLoad: true, reader: new Ext.data.XmlReader({ record: 'price' }, [{name: 'Pri', mapping: '@rate'}]) }); the data which is stored in the "prstore",i want it to copy it into an array. something like var hello = []; hello = prstore.getrange(); but it's not working for me please help thank you

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • specifying multiple URLs with cURL/PHP using square brackets

    - by Raj Gundu
    I have a large array of URLS similar to this: $nodes = array( 'http://www.example.com/product.php?page=1&sortOn=sellprice', 'http://www.example.com/product.php?page=2&sortOn=sellprice', 'http://www.example.com/product.php?page=3&sortOn=sellprice' ); The cURL manual states here (http://curl.haxx.se/docs/manpage.html) that i can use square brackets '[]' to specify multiple urls. Used in the above example this would be similar to this: 'http://www.example.com/product.php?page=[1-3]&sortOn=sellprice' So far i have been unable to reference this correctly. This is the complete code segment I'm currently trying to utilize this with: $nodes = array( 'http://www.example.com/product.php?page=1&sortOn=sellprice', 'http://www.example.com/product.php?page=2&sortOn=sellprice', 'http://www.example.com/product.php?page=3&sortOn=sellprice' ); $node_count = count($nodes); $curl_arr = array(); $master = curl_multi_init(); for($i = 0; $i < $node_count; $i++) { $url =$nodes[$i]; $curl_arr[$i] = curl_init($url); curl_setopt($curl_arr[$i], CURLOPT_RETURNTRANSFER, true); curl_multi_add_handle($master, $curl_arr[$i]); } do { curl_multi_exec($master,$running); } while($running > 0); echo "results: "; for($i = 0; $i < $node_count; $i++) { $results = curl_multi_getcontent ( $curl_arr[$i] ); echo( $i . "\n" . $results . "\n"); echo 'done'; I can't seem to find any more documentation on this. Thanks in advance.

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Silverlight Application

    - by Avijit Singh
    I have prepared a Silverlight application and my database is in the server. Its running smoothly for small set of data but for large data set giving an error : Remote Serve returned an error:notFound. How can i resolve it,please any one solve this problem. I have build it in ASP.NET with C#. So kindly provide the solution in C# if possible.

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • 'mvn install' does not work & shows error while attempting to download

    - by Raj
    I am using maven 3.0.2 version. mvn --version works fine on command line but when I try mvn install it does not work & shows following error. Z:\dev\hector rantavmvn install [INFO] Scanning for projects... Downloading: http://repo1.maven.org/maven2/junit/junit/3.8.2/junit-3.8.2.jar [ERROR] The build could not read 1 project - [Help 1] [ERROR] [ERROR] The project me.prettyprint:hector:0.7.0-24-SNAPSHOT (Z:\dev\hector ran tav\pom.xml) has 1 error [ERROR] Unresolveable build extension: Plugin org.apache.maven.scm:maven-scm -manager-plexus:1.3 or one of its dependencies could not be resolved: Could not transfer artifact junit:junit:jar:3.8.2 from/to central (http://repo1.maven.org/ maven2): Error transferring file: repo1.maven.org: Unknown host repo1.maven.org - [Help 2] [ERROR] [ERROR] To see the full stack trace of the errors, re-run Maven with the -e swit ch. [ERROR] Re-run Maven using the -X switch to enable full debug logging. [ERROR] [ERROR] For more information about the errors and possible solutions, please rea d the following articles: [ERROR] [Help 1] http://cwiki.apache.org/confluence/display/MAVEN/ProjectBuildin gException [ERROR] [Help 2] http://cwiki.apache.org/confluence/display/MAVEN/PluginResoluti onException Z:\dev\hector rantav Please let me how I can fix this.

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • how to create Cross domain asp.net web service

    - by Prithvi Raj Nandiwal
    i have create a web service. i want to access this web service using Ajax jqury. i am able to access on same domain. but i want to access thia web service to another domain. Have any one idea. how to create cross domain web service in asp.net. any setting in web,config file so that i access it on another domain. my webservice [WebService(Namespace = "http://tempuri.org/")] [System.Web.Script.Services.ScriptService] public class Service : System.Web.Services.WebService { public Service () { } [WebMethod] public string SetName(string name) { return "hello my dear friend " + name; } } JavaScript $.ajax({ type: "GET", url:'http://192.168.1.119/Service/SetName.asmx?name=pr', ContentType: "application/x-www-form-urlencoded", cache: false, dataType: "jsonp", success: onSuccess });

    Read the article

  • Help needed regarding CLCorelocation

    - by yogendra singh
    Hello everybody, i am developing a GPS application in which i needs to track the speed of the device/iphone ,i am using the CLCorelocation API's Locate me referral code provided by Apple my problem is that the LocationManager does not updates the current latitude and longitudes thus i am unable to calculate the distance as well as the speed of the device/iphone. Any kinds of suggestions/code will be highly appreciated please suggest me if i can do something with the Mapkit framework introduced in the sdk 3.0. thanks in advance

    Read the article

  • using internationalization on list data

    - by singh
    i am using Struts2 in application. <s:iterator value="listObject"> <s:component template="abc.vm"> <s:param name="text" value="listValue" /> <s:param name="prefix" value="listIndex" /> </s:component> </s:iterator> listValue is a values of list. i am using iterator to traverse the list. now on listValue, i want to put here internationalization concept.so that all the list value can be display based on Locale which store in a list. please suggest!

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >