Search Results

Search found 4498 results on 180 pages for 's expression'.

Page 124/180 | < Previous Page | 120 121 122 123 124 125 126 127 128 129 130 131  | Next Page >

  • Change only Revision number in AssemblyInfo.cs with msbuild FileUpdate task

    - by Divya mohan Singh
    I need to change only the revision number of an AssemblyInfo.cs file. The version number is in the format Major.Minor.Build.Revision e.g. 1.4.6.0. Currently I change the version with the FileUpdate task (from the MSBuild Community Tasks Project) and the following regex: <FileUpdate Files="@(AssemblyResult)" Regex='(\[\s*assembly:\s*AssemblyVersion\(\s*"[^\.]+\.[^\.]+)\.([^\.]+)(\.)([^\.]+)("\)\s*\])' ReplacementText='[assembly: AssemblyVersion("$(AssemblyMajorNumber).$(AssemblyMinorNumber).$(AssemblyBuildNumber).$(Revision)")]' /> Now I need to update only the revision number and leave major,minor and build unchanged. So, is there any task to do this? Or can it be done with a regex? What would be the regular expression then?

    Read the article

  • What is lifetime of lambda-derived implicit functors in C++ ?

    - by Fyodor Soikin
    The question is simple: what is lifetime of that functor object that is automatically generated for me by the C++ compiler when I write a lambda-expression? I did a quick search, but couldn't find a satisfactory answer. In particular, if I pass the lambda somewhere, and it gets remembered there, and then I go out of scope, what's going to happen once my lambda is called later and tries to access my stack-allocated, but no longer alive, captured variables? Or does the compiler prevent such situation in some way? Or what?

    Read the article

  • SImplifying with LINQ - Basic selection

    - by baron
    Hello foreach (var person in peopleList.Where(person => person.FirstName == "Messi")) { selectPeople.Add(person); } I am just wondering if there is any way to simplify this using LINQ. Like rather than look at all the people I was trying to use LINQ to just fill a list with the "Messi"'s... was trying something like... var selectPeople = peopleList.Select(x=>x.FirstName=="Messi"); Then I could just add everyone in that list without a check. But it doesn't quite work as planned. Maybe there's no point simplifying that expression. But the question seemed worthwhile just to strengthen my LINQ knowledge.

    Read the article

  • RegEx, matching if not containing...

    - by Tommy Jakobsen
    I've been trying to figure out how to write this regular expression. It is to be used for ISAPI_Rewrite, a module for IIS 6, for doing URL rewriting. I want the url /hg/<parameter> to be mathed, so it can be rewrited to /hg/hgwebdir.cgi/<parameter>. I've matched it using ^/hg/(.*). My problem is, if the URL /hg/hgwebdir.cgi/<parameter> is used, the regex should NOT match. Using the above regex with this URL, will rewrite to /hg/hgwebdig.cgi/hgwebdig.cgi/<parameter> which is not correct. Can you help me create the matching pattern?

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Parse filename from full path using regular expressions in C#

    - by WindyCityEagle
    How do I pull out the filename from a full path using regular expressions in C#? Say I have the full path C:\CoolDirectory\CoolSubdirectory\CoolFile.txt. How do I get out CoolFile.txt using the .NET flavor of regular expressions? I'm not really good with regular expressions, and my RegEx buddy and me couldn't figure this one out. Also, in the course of trying to solve this problem, I realized that I can just use System.IO.Path.GetFileName, but the fact that I couldn't figure out the regular expression is just making me unhappy and it's going to bother me until I know what the answer is.

    Read the article

  • Proper way in MVVM to drive visual states.

    - by firoso
    Given a content presenter that can display one of 4 different application pages, and I want to fade/otherwise animate a transition between pages based on view model state. Ideally I'd like to have these all defined within a DataTemplate, and then trigger transitions based on an enum from the view model, so that when some enum representing state changes, the transitions trigger to the appropriate page. Is there a known best practice to handle things like this? Immediately coming to mind is the possibiltiy to use Enter and Exit actions on data triggers to play storyboards, but this definately doesn't use the parts and states model, so I'd like to shy away from that. I've also tried using the DataStateSwitchBehavior from the codeplex Expression project, but found it to be incompatable with the latest builds of WPF 4.0/Blend 4 RC's SDK. Does anyone have any ideas on how to handle this elegantly? I'm using the MVVM-Light framework. Also I'd like to point out that as long as this resides on a DataTemplate in a Resource Dictionary, code-behind is not an option without refactoring.

    Read the article

  • Regex to validate SMTP Responses?

    - by Alix Axel
    I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

    Read the article

  • Handling Special char such as ^ÛY, ^ÛR in java

    - by RJ
    Hi, Has anybody encountered special char such as ^ÛY, ^ÛR ? Q1. How do I do an ftp of the files containing these chars? The chars are not seen once I do a ftp on AIX (bi or ascii) and hence I am unable to see my program to replace these, working. Q2. My java program doesn't seem to recognise these or replace these if I search for these explicitly (^ÛY, ^ÛR ) in the file however a replace using regular expression seems to work (I could only see the difference in the length of the string). My program is executed on AIX. Any insights why java cannot recognise these? Q3. Does the Oracle database recognise these chars? An update is failing where my program indicates the string to be of lesser length and without these characters but the db complains "value too large for column" as the string to be updated contains these chars and hence longer. thanks in advance, RJ

    Read the article

  • How to pass Endpoint parameter to Endpoint defined as bean in Spring conext

    - by sempa
    I have camel Fileendpoint defined in following way: <bean id="hotfolderEndpoint" class="org.apache.camel.component.file.FileEndpoint" factory-bean="camel" factory-method="getEndpoint"> <constructor-arg ref="hotfolder" /> </bean> I want to define some File parameters such as preMove, move etc. Variable hotfolder is String taken from JNDI and I have no impact on it. When I define property as <bean id="moveExp" class="org.apache.camel.model.language.SimpleExpression"> <property name="expression" value="done/${file:name}"/> </bean> it is not correctly parsed and the file get name done/name

    Read the article

  • ASP.NET GridView sorting on method data

    - by husainnz
    Hi, I'm binding a GridView to a domain model object, this domain model object has a method for working out a formatted value to display on the grid. I'd like to use this method for my display value, which is fine, but I'd also like to be able to sort on the value returned by that method. My sort expression can only take in a property/field at the moment. Help please! What do I need to do to get this to work? I'm using an SPGridView actually, but that doesn't make a lot of difference to my problem. Thanks.

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • How do I adjust overall width of rdlc report when some columns are hidden?

    - by user115487
    I have a customizable rdlc report where the user can choose which columns to show. All the columns are included in the report designer, and I use parameters to hide/show columns based on the user's choice. The report renders correctly, and only shows the selected columns, HOWEVER, the overall width of the report is the same as if all the columns were visible. This means that the report can have a huge empty area to the right of the selected columns, which looks very silly. So my question: Is there a way to adjust the report width dynamically at runtime to avoid a large silly empty area in the report? I attempted to do this in the designer by assigning a parameter to the width of the report body....but that was not allowed. The width cannot be an expression of any kind in the designer, only an actual value is allowed. Any suggestions?

    Read the article

  • SSRS: Report label position dynamic

    - by Nauman
    I have a report which displays customer address in multiple labels. My customers use windowed envelopes for mailing. I need the address labels position to be configurable. Something like, I'll have a database table which stores the Top/Left position of each label per customer. Based on this table, I need to position the address labels on my report. I thought, it is doable by expressions, but Location property doesn't provides ability to set an expression and make the label's top and left dynamic. Anybody, any ideas, on how to achieve this?

    Read the article

  • How to calculate unbound column value based on value of bound colum in DatagGridView?

    - by Wodzu
    Hi. I have few columns in my DataGridView, one of them is an unbound column and the DataGridVIew is in VirtualMode. When CellValueNeeded event is called, I want to calculate value of Cells[0] basing on the value of Cells[2] which is in bounded column to the underlaying DataSource. This is how I try to do this: private void dgvItems_CellValueNeeded(object sender, DataGridViewCellValueEventArgs e) { e.Value = dgvItems.CurrentRow.Cells[2].Value * 5; //simplified example } However, I am getting System.StackOverflowException because it seams that call to dgvItems.CurrentRow.Cells[2].Value results in call to another CellValueNeeded event. And so on and so on... However Cells[2] is not an unbound column, so on common sense it should not result in recursive call unless getting value of any column(bound or unbound) firest that event... I can not use here SQL Expression and I can not precalculate e.Value in any SQL call. In real example Cells[2].Value is a key used in HashTable which will return a correct value for the Cells[0] (e.Value). What can I do?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Visual Studio confused by server code inside javascript

    - by Felix
    I ran into an annoying problem: the following code gives a warning in Visual Studio. <script type="text/javascript"> var x = <%: ViewData["param"] %>; </script> The warning is "Expected expression". Visual Studion gets confused, and all the javascript code after that is giving tons of warnings. Granted, it's all warnings, and it works perfectly fine in runtime - but it is very easy to miss real warnings among dozen of false positives. It was working the same way in VS2008, and it wasn't fixed in VS2010. Does anybody know if there is a workaround, or a patch?

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Why won't binding to a child object property with rdlc Report work in vs2010?

    - by andrej351
    A while ago someone asked how to bind to a child object's property in a rdlc report. Question here. The solution was to use an expression like this: =Fields!ChildObject.Value.SomeProperty I have recently tried to upgrade to version 10 of the reporting libraries (Microsoft.ReportViewer.WebForms and Microsoft.ReportViewer.Common) and for some reason this does not work anymore. I have got the report rendering and displaying all data fine except any which uses this technique. Instead of the property value i get the text: "#Error" Why doesn't this work anymore? Anybody know how to to this in the new version?

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • Double-Escaped Unicode Javascript Issue

    - by Jeffrey Winter
    I am having a problem displaying a Javascript string with embedded Unicode character escape sequences (\uXXXX) where the initial "\" character is itself escaped as "&#92;" What do I need to do to transform the string so that it properly evaluates the escape sequences and produces output with the correct Unicode character? For example, I am dealing with input such as: "this is a &#92;u201ctest&#92;u201d"; attempting to decode the "&#92;" using a regex expression, e.g.: var out = text.replace('/&#92;/g','\'); results in the output text: "this is a \u201ctest\u201d"; that is, the Unicode escape sequences are displayed as actual escape sequences, not the double quote characters I would like.

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

< Previous Page | 120 121 122 123 124 125 126 127 128 129 130 131  | Next Page >