Search Results

Search found 68407 results on 2737 pages for 'text files'.

Page 125/2737 | < Previous Page | 121 122 123 124 125 126 127 128 129 130 131 132  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • Is there a word processor similar to MS Word which saves files as readable txt files?

    - by zenbomb
    I'm writing a paper together with my supervisor and would like to have a more sophisticated version control than *_291112_NEW_NEW_revised1.doc files. My supervisor is a non-computer person will never ever use LaTeX or git and loves MS Word. I'm therefore looking for an alternative to Word (I need commenting on text passages!) which stores the files as clean text (Markup for formating is fine), so I'm able to put them under version control on my side. I'm aware that git can also handle binary files, but I'd prefer the cleaner way of looking at the contents directly. If there's a way to automatically extract the text from word files, I'm fine with that too for now.

    Read the article

  • Linux: Create files and direcotires but not delete them

    - by Peraz
    I have a process that create directories and files inside a working directory, ex: /workingdir/file1 /workingdir/file2 /workingdir/dir1/file1 /workingdir/dir1/dir2/file1 /workingdir/dir1/file2 I need to avoid deletion/overwrites of created folders/files for that user, but allow subsequent folders/subfolders/files creation. I try permissions, gid, acl with no luck. What is the correct way to do that ? (i can use a cron job if needed)

    Read the article

  • Remove all files except for a few, from a folder in Unix

    - by nikhil
    I often face this problem. I have a set of files in a folder and would like to delete all of them except a few. For example: I have files named according to the date of creation (like 11-1-11.tar, 10-1-11.tar and so on). Now I would like to delete files like 10-1-11, 9-1-11 and so on but not some other files. Basically I would like to enforce what all should be deleted and what should be retained. How would I do this?

    Read the article

  • how to share files over local network in ubuntu

    - by rails_guy
    I am trying to paste some files from my laptop to desktop. both have ubuntu. From the laptop I can see the desktop under Places - Network. I can see the files in the Desktop but when I try to paste a file it says "permission denied" What can I do on the Desktop so it allows my laptop to paste files?

    Read the article

  • Server stop responding, where to look to know what happened?

    - by Cid
    I have a server that has been running for well over 5 months and suddently it stop responding. I couldn't ssh into it or anything else so I decided to reboot it and the reboot fixed it. I'm trying to figure out what happened and I'm not sure exactly where to look. I started to look in /var/log but there are tons of files in there and I'm not sure which one I should pay attention to. I'm slowly going through each one of them but if anyone can point me in the right direction, it would be great. Thanks!

    Read the article

  • Program for keeping encrypted files.

    - by Giorgi
    I am looking for a program which will encrypt files specified by me and allow me to view/edit/delete those files without creating a virtual disk. I do not want to have virtual disk as a domain administrator can access it so truecrypt is not the possibility. One possibility is to use winrar with password protected archive but winrar serves a different goal so it is not very user friendly for this purpose. If it's possible it would be nice if the program does not creates temp files while I open the files. Any suggestions?

    Read the article

  • looking for a command line tool to copy files to remote computers (similar to psexec)

    - by hatchetman82
    hi. im looking for a small utility that can copy files over to/from remote windows hosts, and which can take the credentials (domain user and password) as part of its command line, similar to psexec. i know i can use net use to map the target directory to a drive letter and use xcopy, and i know psexec can upload files to be executed on the remote machine and then delete them, but im looking for a small utility to distribute files to remote hosts that will not be as awkward to use as net use + xcopy

    Read the article

  • Why Netbeans 6.8 remote project (php) uploads all files by default

    - by xaguilars
    Hi I wanted to know if there's some option for disabling Netbeans to upload all files of a recently imported remote (php) project. I always check "Upload files on run", in the project configuration. But when I click on run Netbeans selects all files by default (I modified only some). The file checkboxes cannot be disabled at once and you have to do this one by one (imagine you have 5000 files...). That's annoying. Do you know any solution? thank you

    Read the article

  • Windows log file monitor that supports custom events (eg. sending an email when it detects the string "ERROR")

    - by ilitirit
    I know this question has been asked several times before but I can't seem to find a solution for my requirements. I currently use BareTail, which works wonderfully except that it doesn't support custom events besides line highlighting. I'm also trying TailForWin32. It has a SMTP plugin but it seems to be in beta status, and the highlighting seems limited. It also doesn't handle rolling log files very well (a blocking dialog box pops up, whereas BareTail just rolls over naturally). All I really need is something like BareTail that supports custom events. First prize would be a tool with a plugin-based architecture so I can use my own messaging plugins, but anything that supports SMTP mail would be fine as well.

    Read the article

  • How do I get a listing of music files on a specific drive

    - by Kevin34
    I'm helping someone setup thier IPOD, but they are using Windows 7, and I know XP. I don't see the music in the directory lising on his computer that I see on the IPOD. So I'm trying to search for all music files on e: In Windows XP, this is easy. Windows 7 has changed everything. I googled this, and I found to type "music" in the Windows search bar. This result in music "Libraries." Great. There's still not a listing of the files. I can search for *.wma, but that doesn't list all the music on the IPOD. There are many types of music files, how do I get a list of ALL music files on JUST drive e:? Again, on XP this was VERY easy.

    Read the article

  • DVD/CD burning .zip: is it more reliable, faster, longer lasting to burn a zip of files rather than the files as a folder?

    - by Rob
    Is it more reliable, faster, longer lasting to burn to CD/DVD a zip (or a few large zips) of files rather than the files as a folder? Just thinking if 1000s of small files would not be as efficiently recorded compared with one or a few large zips. Also, even after the burning program verifies the disc, I also use Beyond Compare to compare the files with those on the disc. Always binary compares as identical but I hear the drive stuttering presumably as the head is being shifted only slightly each time to seek the next file, which leads me to think that its best to make one or more zips and copy those locally to compare. Or is it that burning invidual files to the disc is not as readable which causes the head to stutter. There aren't any problems, my disc burns are reliable, just thinking more of efficiency and longevity, the discs burn and verify fast enough on my 18x DVD burner. I'm using ImgBurn mostly. Also used Nero in the past. I burn whole discs closed, finalised. Not sure which write mode but would think Disc At Once from a temporary cached image made by the burning program would be the most reliable.

    Read the article

  • Grep-ing gzipped files [duplicate]

    - by Julien Genestoux
    This question already has an answer here: Grepping through .gz log files 5 answers I have a set of 100 log files, compressed using gzip. I need to find all lines matching a given expression. I'd use grep, but of course, that's a bit of a nightmare because I'll have to unzip all files, one by one, grep them and delete the unzipped version, because they wouldn't all fit on my sevrer if they were all unzipped. Anyone has a little trick on how to get that done quickly?

    Read the article

  • Updating shared files across computers

    - by murgatroid99
    I have a file server running Windows Server 2008 and a couple of laptops running Windows 7 on a network. There are a large number of files that all users will need access to. My plan is to have the files on both the server and the laptops because the users will need to access the files in places with no Internet access. I also want any changes made to the files on any of the laptops to propagate to the server and then propagate to the other laptops whenever they connect to the network. Should I do this with a scheduled batch script with a few xcopy commands or is there a better way to do it?

    Read the article

  • Extract structured data from many MS Word files

    - by Mark
    I have ~160 MS Word files that contain structured data. The data is formatted identically across all files and resides in a tabular format. I'd like to extract the data into a database, XML or just an aggregate table without opening each of the files independently. Is there a tool or method I can use to extract this data?

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • Flash Player is creating thousands of .tmp files

    - by Ed Manet
    We have seen a number of machines in our environment (XP Pro SP3) that have been running out of disk space because of .TMP files in the windows\temp folder. One machine had 6GB of .TMP files on it starting from around August 2010. The files are all 305kb in size and they seem to get created every 10 minutes. The files appear to be either .EXEs or .DLLs when opened in a hex editor. The words "this program can not be run in DOS mode" are at the beginning of the file and the words "Adobe Flash Player" are scattered all over the end of the file (probably the string table). While it's easy enough to clean them up, I'd like to find root cause for the issue. Has anybody else seen this?

    Read the article

  • Adding items to a files right click menu in Windows Explorer

    - by Fire Lancer
    What do I need to do to add an item to the right click menu for files with certain file extensions, along with sub menus? An example would be adding items to run Python files (.py, .pyw, .pyc) with a specific version of Python, so the menu for a .py files would look like say: Open 7-Zip > ...7zip stuff Run > Python 2.5 Python 2.6 Python 3.1 Edit > IDLE 2.5 IDLE 2.6 IDLE 3.1 various other items

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • Search desktop files using a list of keywords stored in a text file

    - by Tod1d
    I have a list of 1285 keywords (database object names) that I have compiled into a TXT file; one keyword per line. I would like to search a directory of files (most have a .aspx or .cs extension) using this list of keywords. My main goal is find out which of the 1285 database objects are being referenced in these files. Can anyone recommend a tool that could accomplish this? Otherwise, I will just create my own. Thanks.

    Read the article

  • Binary diff/patch for large files on linux?

    - by thejh
    I've got two partition images (A and B) and want to use them to create a patch that I can apply on A on another computer in order to get the new B image without flooding the network. I have the following requirements: works on linux can create diffs can use diffs to patch files can handle binary files can handle large files (a few hundred GB should work) no user interaction required (just a console application) ideally, should be able to read from/write to pipes (so that I can pipe into it from a gzip-compressed file and write to one) Does something like that exist?

    Read the article

  • Moving files within an ext4 filesystem?

    - by HT74
    I'd like to decrease the access-time for some files by moving them to the beginning of the fs. Task 1: Clear a certain block range at the beginning of the fs (moving existing files to free space elsewhere). Task 2: Move the files in question to that block range (should be able to grow a bit). How would I do that?

    Read the article

  • How do I open 2 instances of the same file in notepad++ side by side with their own scrollbars in a single Notepad++ window?

    - by Qlidnaque
    I remember doing this a long time ago and have forgotten how I had done it. I like to do this when I have long html or php files to edit and I need part of the code from further down the file in a place nearer to the top, or when I want to compare different parts of the same file. There was a way to do this without opening two instances of Notepad++ and when I clicked on save, it made the saved changes in both instances of the opened file (whereas if I have 2 windows of Notepad++ opened simultaneously, it will prompt me to either update or not update the second opened instance if the first one was saved midway.)

    Read the article

  • Automate Monitor string in different log files

    - by EVIA
    I have few log files in different servers and I want to check output in the end of those log files for e.g . success: 4000 failed: 200 These logs files are getting generated daily and I have to keep track of these numbers. If there is any way I can automate this option instead of going and checking these files and wasting so much of my time. I want to create some kind of script like Go to \serverA\C$\log_07_02_2012.txt and check this line Go to \serverB\C$\log_07_02_2012.txt and check some other line. .... and it should give me output from all of these...

    Read the article

< Previous Page | 121 122 123 124 125 126 127 128 129 130 131 132  | Next Page >