Search Results

Search found 6030 results on 242 pages for 'exists'.

Page 127/242 | < Previous Page | 123 124 125 126 127 128 129 130 131 132 133 134  | Next Page >

  • Generic test suite for ASP.NET Membership/Role/Profile/Session Providers

    - by SztupY
    Hi! I've just created custom ASP.NET Membership, Role, Profile and Session State providers, and I was wondering whether there exists a test suite or something similar to test the implementation of the providers. I've checked some of the open source providers I could find (like the NauckIt.PostgreSQL provider), but neither of them contained unit tests, and all of the forum topics I've found mentioned only a few test cases (like checking whether creating a user works), but this is clearly not a complete test suite for a Membership provider. (And I couldn't find anything for the other three providers) Are there more or less complete test suites for the above mentioned providers, or are there custom providers out there that have at least some testing avaialable?

    Read the article

  • Test if single linked list is circular by traversing it only once

    - by user1589754
    I am a fresher and I was asked this question in a recent interview I gave. The question was --- By traversing each element of linked list just once find if the single linked list is circular at any point. To this I answered that we will store reference of each node while traversing the list in another linked list and for every node in the list being tested we will find if the reference exists in the list I am storing the references. The interviewer said that he needs a more optimized way to solve this problem. Can anyone please tell me what would be a more optimized method to solve this problem.

    Read the article

  • How do I use a command line tool to install .net 4 to IIS

    - by tehp
    I'm trying to deploy my WCF RIA services application to our in-house server for testing. I've been following the instructions and comments from this blog site: http://timheuer.com/blog/archive/2009/12/10/tips-to-deploy-ria-services-troubleshoot.aspx At the end someone points to this question: http://stackoverflow.com/questions/1528324/how-to-solve-a-http-error-404-3-not-found-error I've been trying to run that same tool with .net 4.0 but it keeps giving me an error: [Warning]The HTTP namespace reservation already exists. I am running the version of the exe that I found inside of C:\Windows\Microsoft.NET\Framework\v4.0.21006 There is also C:\Windows\Microsoft.NET\Framework\v3.0\Windows Communication Foundation that has (what I assume is) the same exe in it, and I can use it just fine. I've tried to un-install the 3.0 version before installing the 4.0 version, but I am still getting the same warning and failure. Has anyone successfully done this with .net 4.0?

    Read the article

  • Get the number of calendar weeks between 2 dates in C#

    - by Phil Scholtes
    For the purposes of this question, let's assume the user will be from the US and will use the standard Gregorian calendar. So, a calendar week starts on Sunday and ends on Saturday. What I'm trying to do is determine the number of calendar weeks that exist between two dates. A perfect example of my problem exists in October 2010. Between 10/16 and 10/31 there are 4 calendar weeks. View a picture of October 2010 October 10 - October 16 October 17 - October 23 October 24 - October 30 October 31 - November 6 I'd prefer to stay away from any hardcoded logic like: if (Day == DayOfWeek.Saturday && LastDayOfMonth == 31) { ... } Can anyone think of a logical way to do this?

    Read the article

  • SIMPLE BASH Programming.

    - by atif089
    I am a newbie to BASH so please dont mind my stupid questions because I am not able to get any good sources to learn that. I want to create a script to display filename and its size. This is what the code is like filename=$1 if [ -f $filename ]; then filesize=`du -b $1` echo "The name of file is $1" echo "Its size is $filesize" else echo "The file specified doesnot exists" fi The output is like this $ ./filesize.sh aa The name of file is aa Its size is 88 aa But in the last line I dont want to show the name of the file. How do I do that ? I want to do the same thing using wc as well.

    Read the article

  • How to override the behavior of Spring @Autowired

    - by Mark
    Hi a little background: I am Using Spring 2.5, and specifically spring IOC and annotations. I am using @Autowired in my code (the Autowiring is done by type) and use @Component for exposing Classes to the Automatic wiring. The situation described bellow arose while i tried to test my code. now to the problem: Note: i use a different Spring Context for the Test environment. I have a class FOO which is @Autowired but in the test context i want to use a different class of the same type MockFoo (extends FOO) The Spring Setup of course fails do so automatically due to multiple options for the Dependency Injection of the FOO class (both FOO and MockFOO comply to the Type check) I am looking for a way to inject the test bean instead of the original bean. I expected Spring to allow using the Context configurion file to override a bean injection or to order Spring not to autowire a specific bean BUT All these option seem to exists only for the beans which were originally defined in the Spring Context Configuration file

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Replace into equivalent for postgresql and then autoincrementing an int

    - by Mohamed Ikal Al-Jabir
    Okay no seriously, if a postgresql guru can help out I'm just getting started. Basically what I want is a simple table like such: CREATE TABLE schema.searches ( search_id serial NOT NULL, search_query character varying(255), search_count integer DEFAULT 1, CONSTRAINT pkey_search_id PRIMARY KEY (search_id) ) WITH ( OIDS=FALSE ); I need something like REPLACE INTO for mysql. I don't know if I have to write my own procedure or something? Basically: check if the query already exists if so, just add 1 to the count it not, add it to the db I can do this in my php code but I'd rather all that be done in postgres C engine Thanks for helping

    Read the article

  • JAXB - representing an element as a boolean member?

    - by Marcus
    We have this XML: <Summary> <ValueA>xxx</ValueA> <ValueB/> </Summary> <ValueB/> will never have any attributes or inner elements. It's a boolean type element - it exists (true) or it doesn't (false). JAXB generated a Summary class with a String valueA member, which is good. But for ValueB, JAXB generated a ValueB inner class and a corresponding member: @XmlElement(name = "ValueB") protected Summary.ValueB valueB; But what I'd like is a boolean member and no inner class: @XmlElement(name = "ValueB") protected boolean valueB; How can you do this? I'm not looking to regenerate the classes, I'd like to just make the code change manually.

    Read the article

  • Get latest sql rows based on latest date and per user

    - by Umair
    I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

    Read the article

  • What is the difference between File and FileInfo in C# ?

    - by Lilitu88
    I've been reading that the static methods of the File Class are better used to perform small and few tasks on a file like checking to see if it exists and that we should use an instance of the FileInfo Class if we are going to perform many operations on a specific file. I understand this and can simply use it that way blindly but I would like to know why is there a difference ? What is it about the way they work that make them suitable for different situations ? What is the point of having this 2 different classes that seem do the same in different ways ? It would be helpful if someone could answer at least one of this questions.

    Read the article

  • What are all the disadvantages of using files as a means of communicating between two processes?

    - by Manny
    I have legacy code which I need to improve for performance reasons. My application comprises of two executables that need to exchange certain information. In the legacy code, one exe writes to a file ( the file name is passed as an argument to exe) and the second executable first checks if such a file exists; if does not exist checks again and when it finds it, then goes on to read the contents of the file. This way information in transferred between the two executables. The way the code is structured, the second executable is successful on the first try itself. Now I have to clean this code up and was wondering what are the disadvantages of using files as a means of communication rather than some inter-process communication like pipes.Is opening and reading a file more expensive than pipes? Are there any other disadvantages? And how significant do you think would be the performance degradation. The legacy code is run on both windows and linux.

    Read the article

  • Unable to load the Starteam Dump into SVN

    - by ssarivis
    Hi, I have a dump created from StarTeam 2008 R 2 (10.4.7.-64) using svn importer 1.1-M8. But when I am trying to import the dump its giving me error: * adding path : tags/Test/GH/13_Environment/Process/Capgemini EN Template - Business Case.doc ...svnadmin: File already exists: filesystem 'help\db', transaction '2-2', path 'tags/Test/GH/13_Environment/Process/Capgemini EN Template - Business Case.doc' I can see from the svn admin load o/p that the file has been added already. May be the dump created by SVN Importer is not correct. Can anyone guide me how to solve this ?

    Read the article

  • Real-time aggregation of files from multiple machines to one

    - by dmitry-kay
    I need a tool which gets a list of machine names and file wildcards. Then it connects to all these machines (SSH) and begins to monitor changes (appendings to the end) in each file matched by wildcards. New lines in each such file are saved to the local machine to the file with the same name. (This is a task of real-time log files collecting.) I could use ssh + tail -f, of course, but it is not very robust: if a monitoring process dies and then restarts, some data from remote files may be lost (because tail -f does not save the position at which it is finished before). I may write this tool manually, but before - I'd like to know if such tool already exists or not.

    Read the article

  • Open source political campaign management software?

    - by carolclarinet
    Does anyone know of any active open source projects working on political campaign management software? I looked on sourceforge but didn't see anything relevant from the queries "political", "politics", "donations", "campaign", or in the categories "accounting", "politics" or "voting". I'm involved with a political campaign that is currently paying out the nose for some horribly designed SaaS (whose Name i Guess i should Protect, ahem) to basically just keep track of donations people have made now, donations people have made in the past, donations people have pledged to make, contact information, the way they will likely vote, etc. It's a bit much to manage in spreadsheets, but doesn't seem like it's something complex enough that political campaigns should have to pay for (especially low-budget local ones). I'd love to help out if such a project exists, or start/revive one if it doesn't. Any hints, places to look, etc are much appreciated.

    Read the article

  • Error in MySQL Workbench Forward Engineer Stored Procedures

    - by colithium
    I am using MySQL Workbench (5.1.18 OSS rev 4456) to forward engineer a SQL CREATE script. For every stored procedure, the automatic process outputs something like: DELIMITER // USE DB_Name// DB_Name// DROP procedure IF EXISTS `DB_Name`.`SP_Name` // USE DB_Name// DB_Name// CREATE PROCEDURE `DB_Name`.`SP_Name` (id INT) BEGIN SELECT * FROM Table_Name WHERE Id = id; END// The two lines that are simply the database name followed by the delimiter are errors and are reported as such when running the script. As long as they are ignored, it looks like everything gets created just fine. But why would it add those lines? I am creating the database in the WAMP environment which uses MySQL 5.1.36

    Read the article

  • C -Segmentation fault !

    - by FILIaS
    It seems at least weird to me... The program runs normally.But after I call the enter() function for the 4th time,there is a segmentation fault!I would appreciate any help. With the following function enter() I wanna add user commands' datas to a list. [Some part of the code is already posted on another question of me, but I think I should post it again...as it's a different problem I'm facing now.] /* struct for all the datas that user enters on file*/ typedef struct catalog { char short_name[50]; char surname[50]; signed int amount; char description[1000]; struct catalog *next; }catalog,*catalogPointer; catalogPointer current; catalogPointer head = NULL; void enter(void) //user command: i <name> <surname> <amount> <description> { int n,j=2,k=0; char temp[1500]; char *short_name,*surname,*description; signed int amount; char* params = strchr(command,' ') + 1; //strchr returns a pointer to the 1st space on the command.U want a pointer to the char right after that space. strcpy(temp, params); //params is saved as temp. char *curToken = strtok(temp," "); //strtok cuts 'temp' into strings between the spaces and saves them to 'curToken' printf("temp is:%s \n",temp); printf("\nWhat you entered for saving:\n"); for (n = 0; curToken; ++n) //until curToken ends: { if (curToken) { short_name = malloc(strlen(curToken) + 1); strncpy(short_name, curToken, sizeof (short_name)); } printf("Short Name: %s \n",short_name); curToken = strtok(NULL," "); if (curToken) { surname = malloc(strlen(curToken) + 1); strncpy(surname, curToken,sizeof (surname)); } printf("SurName: %s \n",surname); curToken = strtok(NULL," "); if (curToken) { //int * amount= malloc(sizeof (signed int *)); char *chk; amount = (int) strtol(curToken, &chk, 10); if (!isspace(*chk) && *chk != 0) fprintf(stderr,"Warning: expected integer value for amount, received %s instead\n",curToken); } printf("Amount: %d \n",amount); curToken = strtok(NULL,"\0"); if (curToken) { description = malloc(strlen(curToken) + 1); strncpy(description, curToken, sizeof (description)); } printf("Description: %s \n",description); break; } if (findEntryExists(head, surname,short_name) != NULL) //call function in order to see if entry exists already on the catalog printf("\nAn entry for <%s %s> is already in the catalog!\nNew entry not entered.\n",short_name,surname); else { printf("\nTry to entry <%s %s %d %s> in the catalog list!\n",short_name,surname,amount,description); newEntry(&head,short_name,surname,amount,description); printf("\n**Entry done!**\n"); } // Maintain the list in alphabetical order by surname. } catalogPointer findEntryExists (catalogPointer head, char num[],char first[]) { catalogPointer p = head; while (p != NULL && strcmp(p->surname, num) != 0 && strcmp(p->short_name,first) != 0) { p = p->next; } return p; } catalogPointer newEntry (catalog** headRef,char short_name[], char surname[], signed int amount, char description[]) { catalogPointer newNode = (catalogPointer)malloc(sizeof(catalog)); catalogPointer first; catalogPointer second; catalogPointer tmp; first=head; second=NULL; strcpy(newNode->short_name, short_name); strcpy(newNode->surname, surname); newNode->amount=amount; strcpy(newNode->description, description); while (first!=NULL) { if (strcmp(surname,first->surname)>0) second=first; else if (strcmp(surname,first->surname)==0) { if (strcmp(short_name,first->short_name)>0) second=first; } first=first->next; } if (second==NULL) { newNode->next=head; head=newNode; } else //SEGMENTATION APPEARS WHEN IT GETS HERE! { tmp=second->next; newNode->next=tmp; first->next=newNode; } } UPDATE: SegFault appears only when it gets on the 'else' loop of InsertSort() function. I observed that segmentation fault appears when i try to put on the list names that are after it. For example, if in the list exists: [Name:b Surname:b Amount:6 Description:b] [Name:c Surname:c Amount:5 Description:c] [Name:d Surname:d Amount:4 Description:d] [Name:e Surname:e Amount:3 Description:e] [Name:g Surname:g Amount:2 Description:g] [Name:x Surname:x Amount:1 Description:x] and i put: " x z 77 gege" there is a segmentation but if i put "x a 77 gege" it continues normally....

    Read the article

  • Read only particular fields from CSV File in vb.net

    - by fireBand
    Hi, I have this code to read a CVS file. It reads each line, devides each line by delimiter ',' and stored the field values in array 'strline()' . How do I extract only required fields from the CSV file? For example if I have a CSV File like Type,Group,No,Sequence No,Row No,Date (newline) 0,Admin,3,345678,1,26052010 (newline) 1,Staff,5,78654,3,26052010 I Need only the value of columns Group,Sequence No and date. Thanks in advance for any ideas. Dim myStream As StreamReader = Nothing ' Hold the Parsed Data Dim strlines() As String Dim strline() As String Try myStream = File.OpenText(OpenFile.FileName) If (myStream IsNot Nothing) Then ' Hold the amount of lines already read in a 'counter-variable' Dim placeholder As Integer = 0 strlines = myStream.ReadToEnd().Split(Environment.NewLine) Do While strlines.Length <> -1 ' Is -1 when no data exists on the next line of the CSV file strline = strlines(placeholder).Split(",") placeholder += 1 Loop End If Catch ex As Exception LogErrorException(ex) Finally If (myStream IsNot Nothing) Then myStream.Close() End If End Try

    Read the article

  • Checking for Magento login on external page

    - by LinuxGnut
    I'm hitting a wall here while trying to access items from Magento on an external page (same server, same domain, etc, etc). I want to see if the user is logged into Magento before showing them certain parts on the site. Keep in mind that this code exists outside of Magento. Mage::app("default"); Mage::getSingleton("core/session", array("name" = "frontend")); if (empty($session)) { $session = Mage::getSingleton("customer/session"); } if($session-isLoggedIn()) echo "hi"; $cart = Mage::helper('checkout/cart')-getCart()-getItemsCount(); echo $cart; $cart returns 0, where I definitely have products in my cart. isLoggedIn() also returns false. What am I doing wrong here? Is there an option in Magento that I need to turn on or off to be able to access this information outside of Magento?

    Read the article

  • Msdtc Transaction

    - by Shimjith
    I am using Linked server For Tansaction example Alter Proc [dbo].[usp_Select_TransferingDatasFromServerCheckingforExample] @RserverName varchar(100), ----- Server Name @RUserid Varchar(100), ----- server user id @RPass Varchar(100), ----- Server Password @DbName varchar(100) ----- Server database As Set nocount on Set Xact_abort on Declare @user varchar(100) Declare @userID varchar(100) Declare @Db Varchar(100) Declare @Lserver varchar(100) Select @Lserver = @@servername Select @userID = suser_name() select @User=user Exec('if exists(Select 1 From [Master].[' + @user + '].[sysservers] where srvname = ''' + @RserverName + ''') begin Exec sp_droplinkedsrvlogin ''' + @RserverName + ''',''' + @userID + ''' exec sp_dropserver ''' + @RserverName + ''' end ') set @RserverName='['+@RserverName+']' BEGIN TRY BEGIN TRANSACTION declare @ColumnList varchar(max) set @ColumnList = null select @ColumnList = case when @ColumnList is not null then @ColumnList + ',' + quotename(name) else quotename(name) end from syscolumns where id = object_id('bditm') order by colid set identity_insert Bditm on exec ('Insert Into Bditm ('+ @ColumnList +') Select * From '+ @RserverName + '.'+ @DbName + '.'+ @user + '.Bditm') set identity_insert Bditm off Commit Select 1 End try Begin catch if (@@ERROR < 0) Begin if @@trancount 0 Begin Rollback transaction Select 0 END End End Catch set @RserverName=replace(replace(@RserverName,'[',''),']','') Exec sp_droplinkedsrvlogin @RserverName,@userID Exec sp_dropserver @RserverName this is the Error Occuerd The Microsoft Distributed Transaction Coordinator (MS DTC) has cancelled the distributed transaction.

    Read the article

  • Django - transactions in the model?

    - by orokusaki
    Models (disregard typos / minor syntax issues. It's just pseudo-code): class SecretModel(models.Model): some_unique_field = models.CharField(max_length=25, unique=True) # Notice this is unique. class MyModel(models.Model): secret_model = models.OneToOneField(SecretModel, editable=False) # Not in the form spam = models.CharField(max_length=15) foo = models.IntegerField() def clean(self): SecretModel.objects.create(some_unique_field=self.spam) Now if I go do this: MyModel.objects.create(spam='john', foo='OOPS') # Obviously foo won't take "OOPS" as it's an IntegerField. #.... ERROR HERE MyModel.objects.create(spam='john', foo=5) # So I try again here. #... IntegrityError because SecretModel with some_unique_field = 'john' already exists. I understand that I could put this into a view with a request transaction around it, but I want this to work in the Admin, and via an API, etc. Not just with forms, or views. How is it possible?

    Read the article

  • How to debug a corrupt pdf file?

    - by Joelio
    Hi, im generating pdf files using a ruby library called "prawn". I have one particular file that seems to be considered "Corrupt" by adobe reader. It shows up fine in both preview and in adobe reader. It gives errors like: Sometimes I get: "Could not find the XObject named '%s'. Othertimes I get: "Could not find the XObject named "Im4". Then always I get: "An error exists on this page. Acrobat may not display the page correctly. Please contact the person who created the PDF document to correct the problem." Is there a way to open a pdf with some tool and have it tell you what is technically wrong with the pdf? Im sure I could figure it out quickly with something like this... thanks Joel

    Read the article

  • File.mkdir is not working and I can't understand why

    - by gotch4
    Hello, I've this brief snippet: String target = baseFolder.toString() + entryName; target = target.substring(0, target.length() - 1); File targetdir = new File(target); if (!targetdir.mkdirs()) { throw new Exception("Errore nell'estrazione del file zip"); } doesn't mattere if I leave the last char (that is usually a slash). It's done this way to work on both unix and windows. The path is actually obtained from the URI of the base folder. As you can see from baseFolder.toString() (baseFolder is of type URI and is correct). The base folder actually exists. I can't debug this because all I get is true or false from mkdir, no other explanations.The weird thing is that baseFolder is created as well with mkdir and in that case it works. Now I'm under windows. the value of target just before the creation of targetdir is "file:/C:/Users/dario/jCommesse/jCommesseDB" if I cut and paste it (without the last entry) in windows explore it works...

    Read the article

  • NHibernate Lazy="Extra"

    - by Adam Rackis
    Is there a good explanation out there on what exactly lazy="extra" is capable of? All the posts I've seen all just repeat the fact that it turns references to MyObject.ItsCollection.Count into select count(*) queries (assuming they're not loaded already). I'd like to know if it's capable of more robust things, like turning MyObject.ItsCollection.Any(o => o.Whatever == 5) into a SELECT ...EXISTS query. Section 18.1 of the docs only touches on it. I'm not an NH developer, so I can't really experiment with it and watch SQL Profiler without doing a bit of work getting everything set up; I'm just looking for some sort of reference describing what this feature is capable of. Thank you!

    Read the article

  • JPA getSingleResult() or null

    - by Eugene Ramirez
    Hi. I have an insertOrUpdate method which inserts an Entity when it doesn't exist or update it if it does. To enable this, I have to findByIdAndForeignKey, if it returned null insert if not then update. The problem is how do I check if it exists? So I tried getSingleResult. But it throws an exception if the public Profile findByUserNameAndPropertyName(String userName, String propertyName) { String namedQuery = Profile.class.getSimpleName() + ".findByUserNameAndPropertyName"; Query query = entityManager.createNamedQuery(namedQuery); query.setParameter("name", userName); query.setParameter("propName", propertyName); Object result = query.getSingleResult(); if(result==null)return null; return (Profile)result; } but "getSingleResult" throws an exception. Thanks

    Read the article

< Previous Page | 123 124 125 126 127 128 129 130 131 132 133 134  | Next Page >