Search Results

Search found 9156 results on 367 pages for 'partial match'.

Page 13/367 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • Algorithm to match list of regular expressions

    - by DSII
    I have two algorithmic questions for a project I am working on. I have thought about these, and have some suspicions, but I would love to hear the community's input as well. Suppose I have a string, and a list of N regular expressions (actually they are wildcard patterns representing a subset of full regex functionality). I want to know whether the string matches at least one of the regular expressions in the list. Is there a data structure that can allow me to match the string against the list of regular expressions in sublinear (presumably logarithmic) time? This is an extension of the previous problem. Suppose I have the same situation: a string and a list of N regular expressions, only now each of the regular expressions is paired with an offset within the string at which the match must begin (or, if you prefer, each of the regular expressions must match a substring of the given string beginning at the given offset). To give an example, suppose I had the string: This is a test string and the regex patterns and offsets: (a) his.* at offset 0 (b) his.* at offset 1 The algorithm should return true. Although regex (a) does not match the string beginning at offset 0, regex (b) does match the substring beginning at offset 1 ("his is a test string"). Is there a data structure that can allow me to solve this problem in sublinear time? One possibly useful piece of information is that often, many of the offsets in the list of regular expressions are the same (i.e. often we are matching the substring at offset X many times). This may be useful to leverage the solution to problem #1 above. Thank you very much in advance for any suggestions you may have!

    Read the article

  • MySQL "OR MATCH" hangs (long pause with no answer) on multiple tables

    - by Kerry
    After learning how to do MySQL Full-Text search, the recommended solution for multiple tables was OR MATCH and then do the other database call. You can see that in my query below. When I do this, it just gets stuck in a "busy" state, and I can't access the MySQL database. SELECT a.`product_id`, a.`name`, a.`slug`, a.`description`, b.`list_price`, b.`price`, c.`image`, c.`swatch`, e.`name` AS industry, MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) AS relevance FROM `products` AS a LEFT JOIN `website_products` AS b ON (a.`product_id` = b.`product_id`) LEFT JOIN ( SELECT `product_id`, `image`, `swatch` FROM `product_images` WHERE `sequence` = 0) AS c ON (a.`product_id` = c.`product_id`) LEFT JOIN `brands` AS d ON (a.`brand_id` = d.`brand_id`) INNER JOIN `industries` AS e ON (a.`industry_id` = e.`industry_id`) WHERE b.`website_id` = %d AND b.`status` = %d AND b.`active` = %d AND MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) OR MATCH ( d.`name` ) AGAINST ( '%s' IN BOOLEAN MODE ) GROUP BY a.`product_id` ORDER BY relevance DESC LIMIT 0, 9 Any help would be greatly appreciated.

    Read the article

  • How can I match a twitter username with angular ui router

    - by user3929999
    I need to be able to match a path like '/@someusername' with angular ui router but can't figure out the regex for it. What I have are routes like the following $stateProvider .state('home', {url:'/', templateUrl:'/template/path.html'}) .state('author', {url:'/{username:[regex-to-match-@username-here]}'}) .state('info', {url:'/:slug', templateUrl:'/template/path.html'}) .state('entry', {url:'/:type/:slug', templateUrl:'/template/path.html'}); I need a bit of regex for the 'author' route that will match @usernames. Currently, everything I try is caught by the 'entry' route.

    Read the article

  • MongoDb - $match filter not working in subdocument

    - by Ranjith
    This is Collection Structure [{ "_id" : "....", "name" : "aaaa", "level_max_leaves" : [ { level : "ObjectIdString 1", max_leaves : 4, } ] }, { "_id" : "....", "name" : "bbbb", "level_max_leaves" : [ { level : "ObjectIdString 2", max_leaves : 2, } ] }] I need to find the subdocument value of level_max_leaves.level filter when its matching with given input value. And this how I tried, For example, var empLevelId = 'ObjectIdString 1' ; MyModel.aggregate( {$unwind: "$level_max_leaves"}, {$match: {"$level_max_leaves.level": empLevelId } }, {$group: { "_id": "$level_max_leaves.level", "total": { "$sum": "$level_max_leaves.max_leaves" }}}, function (err, res) { console.log(res); }); But here the $match filter is not working. I can't find out exact results of ObjectIdString 1 If I filter with name field, its working fine. like this, {$match: {"$name": "aaaa" } }, But in subdocument level its returns 0. {$match: {"$level_max_leaves.level": "ObjectIdString 1"} }, My expected result was, { "_id" : "ObjectIdString 1", "total" : 4, }

    Read the article

  • Find last match with python regular expression

    - by SDD
    I wanto to match the last occurence of a simple pattern in a string, e.g. list = re.findall(r"\w+ AAAA \w+", "foo bar AAAA foo2 AAAA bar2) print "last match: ", list[len(list)-1] however, if the string is very long, a huge list of matches is generated. Is there a more direct way to match the second occurence of "AAAA" or should I use this workaround?

    Read the article

  • Match Anything Except a Sub-pattern

    - by Tim Lytle
    I'd like to accomplish what this (invalid I believe) regular expression tries to do: <p><a>([^(<\/a>)]+?)<\/a></p>uniquestring Essentially match anything except a closing anchor tag. Simple non-greedy doesn't help here because `uniquestring' may very well be after another distant closing anchor tag: <p><a>text I don't <tag>want</tag> to match</a></p>random data<p><a>text I do <tag>want to</tag> match</a></p>uniquestring more matches <p><a>of <tag>text I do</tag> want to match</a></p>uniquestring So I have more tag in between the anchor tags. And I'm using the presence of uniquestring to determine if I want to match the data. So a simple non-greedy ends up matching everything from the start of the data I don't want to the end of the data I do want. I know I'm edging close to the problems regular expressions (or at least my knowledge of them) aren't good at solving. I could just through the data at an HTML/XML parser, but it is just one simple(ish) search. Is there some easy way to do this that I'm just missing?

    Read the article

  • RegEx - character not before match

    - by danneth
    I understand the consepts of RegEx, but this is more or less the first time I've actually been trying to write some myself. As a part of a project, I'm attempting to parse out strings which match to a certain domain (actually an array of domains, but let's keep it simple). At first I started out with this: url.match('www.example.com') But I noticed I was also getting input like this: http://www.someothersite.com/page?ref=http://www.example.com These rows will ofcourse match for www.example.com but I wish to exclude them. So I was thinking along these lines: Only match rows that contain www.example.com, but not after a ? character. This is what I came up with: var reg = new RegExp("[^\\?]*" + url + "(\\.*)", "gi"); This does however not seem to work, any suggestions would be greatly appreciated as I fear I've used what little knowledge I yet possess in the matter.

    Read the article

  • Regex: Match any character (including whitespace) except a comma

    - by selecsosi
    I would like to match any character and any whitespace except comma with regex. Only matching any character except comma gives me: [^,]* but I also want to match any whitespace characters, tabs, space, newline, etc. anywhere in the string. For example, I would like to be able to match all of this up until the comma: "bla bla bla" "asdfasdfasdfasdfasdfasdf" "asdfasdfasdf", Is there a simple way to do this without knowing where the whitespace may be?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • efficientcy effort: grep with a vectored pattern or match with a list of values

    - by Elad663
    I guess this is trivial, I apologize, I couldn't find how to do it. I am trying to abstain from a loop, so I am trying to vectorize the process: I need to do something like grep, but where the pattern is a vector. Another option is a match, where the value is not only the first location. For example data (which is not how the real data is, otherswise I would exploit it structure): COUNTRIES=c("Austria","Belgium","Denmark","France","Germany", "Ireland","Italy","Luxembourg","Netherlands", "Portugal","Sweden","Spain","Finland","United Kingdom") COUNTRIES_Target=rep(COUNTRIES,times=4066) COUNTRIES_Origin=rep(COUNTRIES,each=4066) Now, currently I got a loop that: var_pointer=list() for (i in 1:length(COUNTRIES_Origin)) { var_pointer[[i]]=which(COUNTRIES_Origin[i]==COUNTRS_Target) } The problem with match is that match(x=COUNTRIES_Origin,table=COUNTRIES_Target) returns a vector of the same length as COUNTRIES_Origin and the value is the first match, while I need all of them. The issue with grep is that grep(pattern=COUNTRIES_Origin,x=COUNTRIES_Target) is the given warning: Warning message: In grep(pattern = COUNTRIES_Origin, x = COUNTRIES_Target) : argument 'pattern' has length > 1 and only the first element will be used Any suggestions?

    Read the article

  • Search for partial IP address using Windows Search?

    - by Dr. Dre
    I have a folder, c:\projects\, added to Windows Index. I know the indexing is working because I search for stuff in this folder all the time and the results come up very fast, and I've never noticed any accuracy problem until now. (I have had to tweak Indexing options to expand which file types have their contents indexed rather than just the file name, etc, but after that Search has worked pretty well for me). I've encountered a problem while trying to search for references to a particular IP address subnet. I'm trying to find all references to IP's with the pattern "192.168.220.xxx" (AKA, the 192.168.220.0/24, AKA 192.168.220.0/255.255.255.0 IP/netmask). Within Windows Explorer: c:\projects**.* is indexed c:\projects\work\project1\network_list.txt contains several "192.168.220.xxx" IP's Indexing status says all items are indexed (193,000 items). When I try to search for partial IP match, there are no search results. Tried searching for: 192.168.220, 192.168, 192.168.220., 192.168.220., 192.168.220.?, 192.168.220.??, 192.168.220.???, 192.168., 192.168.. Also tried variants of all the above surrounded with double quotes. All the searches returned 0 results. Within MS Outlook 2007: My mailbox, and all my offline .pst's are indexed. I search in Outlook pretty frequently, so I'm pretty sure indexed searches work across inbox and all .pst's. Indexing status in Outlook says all items are indexed. I also have references to these IP's in email, and I'd like to find all of them. Basically same deal as above, can't search for "192.168.220.xxx" IP's. Any way to fix this?

    Read the article

  • iTunes Keeps Crashing After Activating iTunes Match

    - by David
    This morning I activated iTunes Match. There were over 20,000 songs to scan and upload, so I walked away and came back to it this afternoon. Upon returning, I found that iTunes had crashed. Now any time I try to open iTunes, the window displays but within a second (seemingly as soon as it tries to access iTunes Match, but I have no way of confirming that) it crashes. So I effectively can't get iTunes to run. Has this happened for anybody else? Does anybody have any suggestions for fixing or even diagnosing this?

    Read the article

  • OpenBSD pf 'match in all scrub (no-df)' causes HTTPS to be unreachable on mobile network

    - by Frank ter V.
    First of all: excuse me for my poor usage of the English language. For several years I'm experiencing problems with the 'match in all scrub (no-df)' rule in pf. I can't find out what's happening here. I'll try to be clear and simple. The pf.conf has been extremely shortened for this forum posting. Here is my pf.conf: set skip on lo0 match in all scrub (no-df) block all block in quick from urpf-failed pass in on em0 proto tcp from any to 213.125.xxx.xxx port 80 synproxy state pass in on em0 proto tcp from any to 213.125.xxx.xxx port 443 synproxy state pass out on em0 from 213.125.xxx.xxx to any modulate state HTTP and HTTPS are working fine. Until the moment a customer in France (Wanadoo DSL) couldn't view HTTPS pages! I blamed his provider and did no investigation on that problem. But then... I bought an Android Samsung Galaxy SII (Vodafone) to monitor my servers. Hours after I walked out of the telephone store: no HTTPS-connections on my server! I thought my servers were down, drove back to the office very fast. But they were up. I discovered that disabling the rule match in all scrub (no-df) solves the problem. Android phone (Vodafone NL) and Wanadoo DSL FR are now OK on HTTPS. But now I don't have any scrubbing anymore. This is not what I want. Does anyone here understand what is going on? I don't. Enabling scrubbing causes HTTPS webpages not to be loaded on SOME ISP's, but not all. In systat, I strangely DO see a state created and packets received from those ISP's... Still confused. I'm using OpenBSD 5.1/amd64 and OpenBSD 5.0/i386. I have two ISP's at my office (one DSL and one cable). Affects both. This can be reproduced quite easily. I hope someone has experience with this problem. Greetings, Frank

    Read the article

  • Installing mysql-devel to match MySQL version

    - by markxi
    I'm running MySQL 5.1.52 on CentOS 4.6 and I'm trying to install mysql-devel to match my MySQL version. If I do yum install mysql-devel it wants to upgrade MySQL to 5.1.58, yet if I do yum search mysql-devel, in addition to finding 5.1.58, I get a match for: 5.1.52-jason.1 .. utterramblings .. Matched from: mysql-devel Why is yum trying to install an updated version and is there any way to get it to install the correct version without the need to upgrade MySQL? I'd appreciate any help.

    Read the article

  • Windows 8.1 Search does not automatically select first search match

    - by Miguel Sevilla
    When I search in Windows 8/8.1 (start menu-start typing), it doesn't automatically highlight the search term. For example, if I'm trying to open the "Internet Options" panel and type the entire thing out in search, I have to down arrow or tab to the "Internet Options" search result. This is retarded. I'm used to Windows 7 style search where the first match is highlighted and i can easily just hit return. First match highlighting does work for other built-in things like "Control Panel", but it should work for all things in general, as it did in Windows 7 search. Anyways, if there is an option to enable this in Windows 8/8.1, I'd appreciate the tip. Thanks!

    Read the article

  • Word is ignoring my 'Match Destination Formatting' preference when pasting text

    - by CreeDorofl
    I'm stuck using word 2007 at the office. It has options for retaining formatting, pasting as plain text, and pasting text to match the destination's formatting. That last option is the one I want, but word is blatantly ignoring it. I copy some text from a PDF, paste into word, and it retains the PDF's formatting... even though I went into options -- advanced -- changed all the dropdowns to "Match Destination Formatting". It also ignores "text only" option... It retains the exact mix of bold, italic, normal text & fonts. I can work around it by pasting to a plain text file, then pasting into word. Or I can do paste special -- unformatted text. But this is so irritating... I just want to ctrl+V and not hassle with it every single time. Is there a better fix?

    Read the article

  • Match exactly (and only) the pattern I specify in a grep command

    - by palswim
    Usually, grep searches for all lines containing a match for the pattern/parameter I specify. I would like to match just the pattern (i.e. not the whole line). So, if a file contains the lines: We said that we'll come. Unfortunately, we were delayed. Now, we're on our way. I want to find all contractions starting with "we" (regex pattern: we\'[a-z]+/i). And I'm looking for the output: we'll we're How do I do this (with grep or another Unix/Windows command-line tool)?

    Read the article

  • VIM autocompletion: Making ^X^U expand to longest match

    - by Sarah
    I'm using eclim to bring some eclipse functionality to VIM, however the code completion functions seem to work less than ideal. When I press ctrl+x ctrl+u after, for instance, System.out. with the curser right after the last dot, I get the completion popup-menu. This menu is really rather cumbersome to use, and the functionality that I would ideally want is something like: ctrl+x ctrl+u (expands to longest match) fill in more characters (expand to longest match). Is this possible somehow? I've tried fiddling with the completeopts settings, but they don't seem to do what I want.

    Read the article

  • Nginx location to match query parameters

    - by Dave
    Is it possible in nginx to have a location {} block that matches query parameters. For example I want to pick up that "preview=true" in this url and then instruct it to do several different things, all possible in a location block. http://192.158.0.1/web/test.php?hello=test&preview=true&another=var The problem I'm having is that my test stuff doesn't seem to match, it seems like I can only match the URL itself? E.g. location ~ ^(.*)(preview)(.*)$ Or something aloong those lines?

    Read the article

  • match patterns update output file uncomment when desired

    - by user2692634
    Need suggestion for following. Have two files myfile and responsefile. First file myfile.txt user=myname user_1=yourname group=mygroup group_1=yourgroup second file responsefile.txt #Please fill details user= #user_1= #user_2= #Please fill details group= #group_1= #group_2= Based on myfile.txt data update responsefile.txt as below and the file responsefile.txt is lenghty of about 604L, 16481C. Result output responsefile.txt #Please fill details user=myname user_1=yourname #user_2= #Please fill details group=mygroup group_1=yourgroup #group_2= If you observe myfile above, I want to match user= in responsefile, then update as user=myname, same applies for group=. Then match user_1= and group_1= which is hashed or commented in responsefile, update as user_1=yourname and group_1=yourgroup. Should not remove hash or uncomment for others in file. I tried this awk -F= 'NR==FNR{a[$1]=$0;next}$1 in a{$0=a[$1]}1' myfile.txt responsefile.txt Please suggest thanks in advance.

    Read the article

  • Quantal: Broken apt-index, cant fix dependencies

    - by arcyqwerty
    I can't seem to add/remove/update packages Ubuntu software update has a notice about partial upgrades but fails Seems to be similar to this problem $ sudo apt-get update Ign http://archive.ubuntu.com quantal InRelease Ign http://security.ubuntu.com precise-security InRelease Ign http://us.archive.ubuntu.com precise InRelease Ign http://extras.ubuntu.com precise InRelease Ign http://us.archive.ubuntu.com precise-updates InRelease Ign http://us.archive.ubuntu.com precise-backports InRelease Ign http://ppa.launchpad.net precise InRelease Ign http://archive.canonical.com precise InRelease Ign http://ppa.launchpad.net precise InRelease Ign http://ppa.launchpad.net precise InRelease Hit http://archive.ubuntu.com quantal Release.gpg Get:1 http://security.ubuntu.com precise-security Release.gpg [198 B] Hit http://extras.ubuntu.com precise Release.gpg Get:2 http://us.archive.ubuntu.com precise Release.gpg [198 B] Get:3 http://us.archive.ubuntu.com precise-updates Release.gpg [198 B] Hit http://archive.canonical.com precise Release.gpg Hit http://ppa.launchpad.net precise Release.gpg Hit http://ppa.launchpad.net precise Release.gpg Hit http://archive.ubuntu.com quantal Release Get:4 http://security.ubuntu.com precise-security Release [49.6 kB] Get:5 http://us.archive.ubuntu.com precise-backports Release.gpg [198 B] Get:6 http://us.archive.ubuntu.com precise Release [49.6 kB] Hit http://extras.ubuntu.com precise Release Hit http://archive.canonical.com precise Release Hit http://ppa.launchpad.net precise Release.gpg Hit http://ppa.launchpad.net precise Release Hit http://archive.ubuntu.com quantal/main amd64 Packages Hit http://extras.ubuntu.com precise/main Sources Hit http://archive.canonical.com precise/partner Sources Hit http://ppa.launchpad.net precise Release Hit http://ppa.launchpad.net precise Release Get:7 http://us.archive.ubuntu.com precise-updates Release [49.6 kB] Hit http://extras.ubuntu.com precise/main amd64 Packages Hit http://extras.ubuntu.com precise/main i386 Packages Hit http://archive.ubuntu.com quantal/main i386 Packages Hit http://archive.ubuntu.com quantal/main Translation-en Hit http://archive.canonical.com precise/partner amd64 Packages Hit http://archive.canonical.com precise/partner i386 Packages Hit http://ppa.launchpad.net precise/main Sources Hit http://ppa.launchpad.net precise/main amd64 Packages Hit http://ppa.launchpad.net precise/main i386 Packages Get:8 http://us.archive.ubuntu.com precise-backports Release [49.6 kB] Hit http://ppa.launchpad.net precise/main Sources Get:9 http://security.ubuntu.com precise-security/main Sources [22.5 kB] Hit http://ppa.launchpad.net precise/main amd64 Packages Hit http://ppa.launchpad.net precise/main i386 Packages Hit http://ppa.launchpad.net precise/main Sources Hit http://ppa.launchpad.net precise/main amd64 Packages Hit http://ppa.launchpad.net precise/main i386 Packages Get:10 http://us.archive.ubuntu.com precise/main Sources [934 kB] Get:11 http://security.ubuntu.com precise-security/restricted Sources [14 B] Get:12 http://security.ubuntu.com precise-security/universe Sources [7,832 B] Ign http://archive.ubuntu.com quantal/main Translation-en_US Get:13 http://security.ubuntu.com precise-security/multiverse Sources [713 B] Get:14 http://security.ubuntu.com precise-security/main amd64 Packages [67.8 kB] Ign http://archive.canonical.com precise/partner Translation-en_US Get:15 http://security.ubuntu.com precise-security/restricted amd64 Packages [14 B] Get:16 http://security.ubuntu.com precise-security/universe amd64 Packages [18.8 kB] Ign http://extras.ubuntu.com precise/main Translation-en_US Ign http://archive.canonical.com precise/partner Translation-en Get:17 http://security.ubuntu.com precise-security/multiverse amd64 Packages [1,155 B] Get:18 http://security.ubuntu.com precise-security/main i386 Packages [70.2 kB] Ign http://extras.ubuntu.com precise/main Translation-en Ign http://ppa.launchpad.net precise/main Translation-en_US Get:19 http://security.ubuntu.com precise-security/restricted i386 Packages [14 B] Get:20 http://security.ubuntu.com precise-security/universe i386 Packages [19.0 kB] Get:21 http://security.ubuntu.com precise-security/multiverse i386 Packages [1,394 B] Ign http://ppa.launchpad.net precise/main Translation-en Hit http://security.ubuntu.com precise-security/main Translation-en Hit http://security.ubuntu.com precise-security/multiverse Translation-en Hit http://security.ubuntu.com precise-security/restricted Translation-en Ign http://ppa.launchpad.net precise/main Translation-en_US Ign http://ppa.launchpad.net precise/main Translation-en Ign http://ppa.launchpad.net precise/main Translation-en_US Ign http://ppa.launchpad.net precise/main Translation-en Hit http://security.ubuntu.com precise-security/universe Translation-en Ign http://security.ubuntu.com precise-security/main Translation-en_US Ign http://security.ubuntu.com precise-security/multiverse Translation-en_US Ign http://security.ubuntu.com precise-security/restricted Translation-en_US Ign http://security.ubuntu.com precise-security/universe Translation-en_US Get:22 http://us.archive.ubuntu.com precise/restricted Sources [5,470 B] Get:23 http://us.archive.ubuntu.com precise/universe Sources [5,019 kB] Get:24 http://us.archive.ubuntu.com precise/multiverse Sources [155 kB] Get:25 http://us.archive.ubuntu.com precise/main amd64 Packages [1,273 kB] Get:26 http://us.archive.ubuntu.com precise/restricted amd64 Packages [8,452 B] Get:27 http://us.archive.ubuntu.com precise/universe amd64 Packages [4,786 kB] Get:28 http://us.archive.ubuntu.com precise/multiverse amd64 Packages [119 kB] Get:29 http://us.archive.ubuntu.com precise/main i386 Packages [1,274 kB] Get:30 http://us.archive.ubuntu.com precise/restricted i386 Packages [8,431 B] Get:31 http://us.archive.ubuntu.com precise/universe i386 Packages [4,796 kB] Get:32 http://us.archive.ubuntu.com precise/multiverse i386 Packages [121 kB] Hit http://us.archive.ubuntu.com precise/main Translation-en Hit http://us.archive.ubuntu.com precise/multiverse Translation-en Hit http://us.archive.ubuntu.com precise/restricted Translation-en Hit http://us.archive.ubuntu.com precise/universe Translation-en Get:33 http://us.archive.ubuntu.com precise-updates/main Sources [124 kB] Get:34 http://us.archive.ubuntu.com precise-updates/restricted Sources [1,379 B] Get:35 http://us.archive.ubuntu.com precise-updates/universe Sources [30.9 kB] Get:36 http://us.archive.ubuntu.com precise-updates/multiverse Sources [1,058 B] Get:37 http://us.archive.ubuntu.com precise-updates/main amd64 Packages [311 kB] Get:38 http://us.archive.ubuntu.com precise-updates/restricted amd64 Packages [2,417 B] Get:39 http://us.archive.ubuntu.com precise-updates/universe amd64 Packages [85.4 kB] Get:40 http://us.archive.ubuntu.com precise-updates/multiverse amd64 Packages [1,829 B] Get:41 http://us.archive.ubuntu.com precise-updates/main i386 Packages [314 kB] Get:42 http://us.archive.ubuntu.com precise-updates/restricted i386 Packages [2,439 B] Get:43 http://us.archive.ubuntu.com precise-updates/universe i386 Packages [85.9 kB] Get:44 http://us.archive.ubuntu.com precise-updates/multiverse i386 Packages [2,047 B] Hit http://us.archive.ubuntu.com precise-updates/main Translation-en Hit http://us.archive.ubuntu.com precise-updates/multiverse Translation-en Hit http://us.archive.ubuntu.com precise-updates/restricted Translation-en Hit http://us.archive.ubuntu.com precise-updates/universe Translation-en Get:45 http://us.archive.ubuntu.com precise-backports/main Sources [1,845 B] Get:46 http://us.archive.ubuntu.com precise-backports/restricted Sources [14 B] Get:47 http://us.archive.ubuntu.com precise-backports/universe Sources [11.1 kB] Get:48 http://us.archive.ubuntu.com precise-backports/multiverse Sources [1,383 B] Get:49 http://us.archive.ubuntu.com precise-backports/main amd64 Packages [1,271 B] Get:50 http://us.archive.ubuntu.com precise-backports/restricted amd64 Packages [14 B] Get:51 http://us.archive.ubuntu.com precise-backports/universe amd64 Packages [9,701 B] Get:52 http://us.archive.ubuntu.com precise-backports/multiverse amd64 Packages [996 B] Get:53 http://us.archive.ubuntu.com precise-backports/main i386 Packages [1,271 B] Get:54 http://us.archive.ubuntu.com precise-backports/restricted i386 Packages [14 B] Get:55 http://us.archive.ubuntu.com precise-backports/universe i386 Packages [9,703 B] Get:56 http://us.archive.ubuntu.com precise-backports/multiverse i386 Packages [999 B] Hit http://us.archive.ubuntu.com precise-backports/main Translation-en Hit http://us.archive.ubuntu.com precise-backports/multiverse Translation-en Hit http://us.archive.ubuntu.com precise-backports/restricted Translation-en Hit http://us.archive.ubuntu.com precise-backports/universe Translation-en Ign http://us.archive.ubuntu.com precise/main Translation-en_US Ign http://us.archive.ubuntu.com precise/multiverse Translation-en_US Ign http://us.archive.ubuntu.com precise/restricted Translation-en_US Ign http://us.archive.ubuntu.com precise/universe Translation-en_US Ign http://us.archive.ubuntu.com precise-updates/main Translation-en_US Ign http://us.archive.ubuntu.com precise-updates/multiverse Translation-en_US Ign http://us.archive.ubuntu.com precise-updates/restricted Translation-en_US Ign http://us.archive.ubuntu.com precise-updates/universe Translation-en_US Ign http://us.archive.ubuntu.com precise-backports/main Translation-en_US Ign http://us.archive.ubuntu.com precise-backports/multiverse Translation-en_US Ign http://us.archive.ubuntu.com precise-backports/restricted Translation-en_US Ign http://us.archive.ubuntu.com precise-backports/universe Translation-en_US Fetched 19.9 MB in 34s (571 kB/s) Reading package lists... Done $ sudo apt-get upgrade Reading package lists... Done Building dependency tree Reading state information... Done You might want to run 'apt-get -f install' to correct these. The following packages have unmet dependencies: netbase : Breaks: ifupdown (< 0.7) Breaks: ifupdown:i386 (< 0.7) E: Unmet dependencies. Try using -f. $ sudo apt-get -f install Reading package lists... Done Building dependency tree Reading state information... Done Correcting dependencies... Done The following packages were automatically installed and are no longer required: dh-apparmor html2text libmail-sendmail-perl libsys-hostname-long-perl Use 'apt-get autoremove' to remove them. The following extra packages will be installed: ifupdown Suggested packages: rdnssd The following packages will be upgraded: ifupdown 1 upgraded, 0 newly installed, 0 to remove and 1179 not upgraded. 85 not fully installed or removed. Need to get 0 B/54.1 kB of archives. After this operation, 19.5 kB of additional disk space will be used. Do you want to continue [Y/n]? (Reading database ... 222498 files and directories currently installed.) Preparing to replace ifupdown 0.7~beta2ubuntu8 (using .../ifupdown_0.7.1ubuntu1_amd64.deb) ... Unpacking replacement ifupdown ... dpkg: error processing /var/cache/apt/archives/ifupdown_0.7.1ubuntu1_amd64.deb (--unpack): trying to overwrite '/etc/init.d/networking', which is also in package netbase 5.0ubuntu1 Processing triggers for man-db ... Processing triggers for ureadahead ... Errors were encountered while processing: /var/cache/apt/archives/ifupdown_0.7.1ubuntu1_amd64.deb E: Sub-process /usr/bin/dpkg returned an error code (1) cat /etc/apt/sources.list # deb cdrom:[Ubuntu 12.04 LTS _Precise Pangolin_ - Release amd64 (20120425)]/ dists/precise/main/binary-i386/ # deb cdrom:[Ubuntu 12.04 LTS _Precise Pangolin_ - Release amd64 (20120425)]/ dists/precise/restricted/binary-i386/ # deb cdrom:[Ubuntu 12.04 LTS _Precise Pangolin_ - Release amd64 (20120425)]/ precise main restricted # See http://help.ubuntu.com/community/UpgradeNotes for how to upgrade to # newer versions of the distribution. deb http://us.archive.ubuntu.com/ubuntu/ precise main restricted deb-src http://us.archive.ubuntu.com/ubuntu/ precise main restricted ## Major bug fix updates produced after the final release of the ## distribution. deb http://us.archive.ubuntu.com/ubuntu/ precise-updates main restricted deb-src http://us.archive.ubuntu.com/ubuntu/ precise-updates main restricted ## N.B. software from this repository is ENTIRELY UNSUPPORTED by the Ubuntu ## team. Also, please note that software in universe WILL NOT receive any ## review or updates from the Ubuntu security team. deb http://us.archive.ubuntu.com/ubuntu/ precise universe deb-src http://us.archive.ubuntu.com/ubuntu/ precise universe deb http://us.archive.ubuntu.com/ubuntu/ precise-updates universe deb-src http://us.archive.ubuntu.com/ubuntu/ precise-updates universe ## N.B. software from this repository is ENTIRELY UNSUPPORTED by the Ubuntu ## team, and may not be under a free licence. Please satisfy yourself as to ## your rights to use the software. Also, please note that software in ## multiverse WILL NOT receive any review or updates from the Ubuntu ## security team. deb http://us.archive.ubuntu.com/ubuntu/ precise multiverse deb-src http://us.archive.ubuntu.com/ubuntu/ precise multiverse deb http://us.archive.ubuntu.com/ubuntu/ precise-updates multiverse deb-src http://us.archive.ubuntu.com/ubuntu/ precise-updates multiverse ## N.B. software from this repository may not have been tested as ## extensively as that contained in the main release, although it includes ## newer versions of some applications which may provide useful features. ## Also, please note that software in backports WILL NOT receive any review ## or updates from the Ubuntu security team. deb http://us.archive.ubuntu.com/ubuntu/ precise-backports main restricted universe multiverse deb-src http://us.archive.ubuntu.com/ubuntu/ precise-backports main restricted universe multiverse deb http://security.ubuntu.com/ubuntu precise-security main restricted deb-src http://security.ubuntu.com/ubuntu precise-security main restricted deb http://security.ubuntu.com/ubuntu precise-security universe deb-src http://security.ubuntu.com/ubuntu precise-security universe deb http://security.ubuntu.com/ubuntu precise-security multiverse deb-src http://security.ubuntu.com/ubuntu precise-security multiverse ## Uncomment the following two lines to add software from Canonical's ## 'partner' repository. ## This software is not part of Ubuntu, but is offered by Canonical and the ## respective vendors as a service to Ubuntu users. deb http://archive.canonical.com/ubuntu precise partner deb-src http://archive.canonical.com/ubuntu precise partner ## This software is not part of Ubuntu, but is offered by third-party ## developers who want to ship their latest software. deb http://extras.ubuntu.com/ubuntu precise main deb-src http://extras.ubuntu.com/ubuntu precise main deb http://archive.ubuntu.com/ubuntu/ quantal main

    Read the article

  • RoR: Replace_html with partial and collection not functioning

    - by Jack
    I am trying to create a tabbed interface using the prototype helper method "replace_html." I have three different partials I am working with. The first one is the 'main tab' and it is loaded automatically like so: <div id = "grid"> <% things_today = things.find_things_today %> <%= render :partial => "/todaything", :collection => things_today, :as =>:thing %> </div> ...which works fine. Similarly, I have a _tomorrowthing partial which would replace the content in the 'grid' div like so: <%things_tomorrow = things.find_things_tomorrow%> <%= link_to_function('Tomorrow',nil, :id=>'tab') do |page| page.replace_html 'grid' , :partial => '/tomorrowthing',:collection => things_tomorrow, :as => :thing end %> If I click on this tab nothing happens at all. Using firebug, the only errors I find are a missing ) after argument list which is contained in the Element.update block where the link_to_function is called. What am I doing wrong?

    Read the article

  • serving mp3s to mobile devices is flooding nginx with partial requests

    - by drumfire
    I am serving mp3s with a minimalistic nginx server. What I see in my log files is that there are a lot of requests, in particular from AppleCoreMedia and sometimes Android useragents, that flood the server with short requests. Sometimes they keep requesting to download the same partial content for a very long time; sometimes more than an hour. For example: "GET /somefile.mp3 HTTP/1.1" 206 33041 "AppleCoreMedia/1.0.0.9B206 (iPhone; U; CPU OS 5_1_1 like Mac OS X; en_us)" "GET /somefile.mp3 HTTP/1.1" 206 33041 "AppleCoreMedia/1.0.0.9B206 (iPhone; U; CPU OS 5_1_1 like Mac OS X; en_us)" "GET /somefile.mp3 HTTP/1.1" 206 33041 "AppleCoreMedia/1.0.0.9B206 (iPhone; U; CPU OS 5_1_1 like Mac OS X; en_us)" [...] I also get a lot, but not as much, of these: "-" 400 0 "-" "-" 400 0 "-" The IP addresses are always from clients that start downloading shortly after that request, usually they have roughly the same UserAgent as in the first example. emphasized text I have enabled server throttling and connection limits in nginx to limit the huge amount of log entries from equivalent IPs at least somewhat. There was a performance issue when I saw the same behaviour on the previous server that used Apache. I installed nginx on a better server then moved the site. When Apache could not handle more connections from the increasing number of clients effectively that server was ddossed. There was no bandwidth issue with already connected clients and I don't know if the already connected clients were using more than one connection at a time. Please tell me: Are clients that appear to get stuck on a download a Bad Thing™ I heard people say their mobile bandwidth use was much higher than they could account for. I'm thinking this type of client behaviour can account for that. And costs us more bandwidth too. Which up to date alternatives exist out there that can handle serving this type of data better than plain HTTP? Useful general insights for someone who just came into this field straight out of the late 90s. :-)

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >