Search Results

Search found 11421 results on 457 pages for 'zend db'.

Page 130/457 | < Previous Page | 126 127 128 129 130 131 132 133 134 135 136 137  | Next Page >

  • Safari corrupting downloads?

    - by Kaji
    First off, a bit of background: I had to do an erase and install about 2-3 weeks ago, so this is a fresh, up-to-date installation of Snow Leopard we're dealing with. That said, I decided recently to branch out from simply programming PHP in a text editor and explore some of the other technologies I keep hearing about, and picked up Drupal, Joomla, and the Zend Framework from their respective official sites. Latest complete, stable builds for all 3. Drupal and Joomla downloaded without a problem, but when I put them in my /~username/Sites folder, XAMPP pretends they're not there, even if I restart Apache or the laptop itself. Zend's archive won't open at all. Is Safari corrupting the downloads, or are there other issues in play that can be investigated?

    Read the article

  • Trouble installing php memcache extension

    - by 2020vert
    I'm trying to install memcache on MAMP but I get the warning below, and when I continue it seems to complete properly. I add the line extension=memcache.so to the php.ini and restart MAMP but phpinfo() doesn't list the memcache extension. $ ./pecl install memcache downloading memcache-2.2.5.tgz ... Starting to download memcache-2.2.5.tgz (35,981 bytes) ..........done: 35,981 bytes 11 source files, building WARNING: php_bin /Applications/MAMP/bin/php5/bin/php appears to have a suffix 5/bin/php, but config variable php_suffix does not match running: phpize Configuring for: PHP Api Version: 20041225 Zend Module Api No: 20060613 Zend Extension Api No: 220060519 Enable memcache session handler support? [yes] : yes ... Build process completed successfully Installing '/Applications/MAMP/bin/php5/lib/php/extensions/no-debug-non-zts-20060613/memcache.so' install ok: channel://pecl.php.net/memcache-2.2.5 configuration option "php_ini" is not set to php.ini location You should add "extension=memcache.so" to php.ini

    Read the article

  • UnicodeEncodeError when uploading files in Django admin

    - by Samuel Linde
    Note: I asked this question on StackOverflow, but I realize this might be a more proper place to ask this kind of question. I'm trying to upload a file called 'Testaråäö.txt' via the Django admin app. I'm running Django 1.3.1 with Gunicorn 0.13.4 and Nginx 0.7.6.7 on a Debian 6 server. Database is PostgreSQL 8.4.9. Other Unicode data is saved to the database with no problem, so I guess the problem must be with the filesystem somehow. I've set http { charset utf-8; } in my nginx.conf. LC_ALL and LANG is set to 'sv_SE.UTF-8'. Running 'locale' verifies this. I even tried setting LC_ALL and LANG in my nginx init script just to make sure locale is set properly. Here's the traceback: Traceback (most recent call last): File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/handlers/base.py", line 111, in get_response response = callback(request, *callback_args, **callback_kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/options.py", line 307, in wrapper return self.admin_site.admin_view(view)(*args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 93, in _wrapped_view response = view_func(request, *args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/views/decorators/cache.py", line 79, in _wrapped_view_func response = view_func(request, *args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/sites.py", line 197, in inner return view(request, *args, **kwargs) File "/srv/django/letebo/app/cms/admin.py", line 81, in change_view return super(PageAdmin, self).change_view(request, obj_id) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 28, in _wrapper return bound_func(*args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 93, in _wrapped_view response = view_func(request, *args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 24, in bound_func return func(self, *args2, **kwargs2) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/transaction.py", line 217, in inner res = func(*args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/options.py", line 985, in change_view self.save_formset(request, form, formset, change=True) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/options.py", line 677, in save_formset formset.save() File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/forms/models.py", line 482, in save return self.save_existing_objects(commit) + self.save_new_objects(commit) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/forms/models.py", line 613, in save_new_objects self.new_objects.append(self.save_new(form, commit=commit)) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/forms/models.py", line 717, in save_new obj.save() File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/base.py", line 460, in save self.save_base(using=using, force_insert=force_insert, force_update=force_update) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/base.py", line 504, in save_base self.save_base(cls=parent, origin=org, using=using) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/base.py", line 543, in save_base for f in meta.local_fields if not isinstance(f, AutoField)] File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/fields/files.py", line 255, in pre_save file.save(file.name, file, save=False) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/fields/files.py", line 92, in save self.name = self.storage.save(name, content) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/files/storage.py", line 48, in save name = self.get_available_name(name) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/files/storage.py", line 74, in get_available_name while self.exists(name): File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/files/storage.py", line 218, in exists return os.path.exists(self.path(name)) File "/srv/.virtualenvs/letebo/lib/python2.6/genericpath.py", line 18, in exists st = os.stat(path) UnicodeEncodeError: 'ascii' codec can't encode characters in position 52-54: ordinal not in range(128) I tried running Gunicorn with debugging turned on, and the file uploads without any problem at all. I suppose this must mean that the issue is with Nginx. Still beats me where to look, though. Here are the raw response headers from Gunicorn and Nginx, if it makes any sense: Gunicorn: HTTP/1.1 302 FOUND Server: gunicorn/0.13.4 Date: Thu, 09 Feb 2012 14:50:27 GMT Connection: close Transfer-Encoding: chunked Expires: Thu, 09 Feb 2012 14:50:27 GMT Vary: Cookie Last-Modified: Thu, 09 Feb 2012 14:50:27 GMT Location: http://my-server.se:8000/admin/cms/page/15/ Cache-Control: max-age=0 Content-Type: text/html; charset=utf-8 Set-Cookie: messages="yada yada yada"; Path=/ Nginx: HTTP/1.1 500 INTERNAL SERVER ERROR Server: nginx/0.7.67 Date: Thu, 09 Feb 2012 14:50:57 GMT Content-Type: text/html; charset=utf-8 Transfer-Encoding: chunked Connection: close Vary: Cookie 500 UPDATE: Both locale.getpreferredencoding() and sys.getfilesystemencoding() outputs 'UTF-8'. locale.getdefaultlocale() outputs ('sv_SE', 'UTF8'). This seem correct to me, so I'm still not sure why I keep getting these errors.

    Read the article

  • “Disk /dev/xvda1 doesn't contain a valid partition table”

    - by Simpanoz
    Iam newbie to EC2 and Ubuntu 11 (EC2 Free tier Ubuntu). I have made following commands. sudo mkfs -t ext4 /dev/xvdf6 sudo mkdir /db sudo vim /etc/fstab /dev/xvdf6 /db ext4 noatime,noexec,nodiratime 0 0 sudo mount /dev/xvdf6 /db fdisk -l I got following output. Can some one guide me what I am doing wrong and how it can be rectified. Disk /dev/xvda1: 8589 MB, 8589934592 bytes 255 heads, 63 sectors/track, 1044 cylinders, total 16777216 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Disk /dev/xvda1 doesn't contain a valid partition table Disk /dev/xvdf6: 6442 MB, 6442450944 bytes 255 heads, 63 sectors/track, 783 cylinders, total 12582912 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Disk /dev/xvdf6 doesn't contain a valid partition table.

    Read the article

  • Trouble installing php memcache extension

    - by user35346
    I'm trying to install memcache on MAMP but I get the warning below, and when I continue it seems to complete properly. I add the line extension=memcache.so to the php.ini and restart MAMP but phpinfo() doesn't list the memcache extension. $ ./pecl install memcache downloading memcache-2.2.5.tgz ... Starting to download memcache-2.2.5.tgz (35,981 bytes) ..........done: 35,981 bytes 11 source files, building WARNING: php_bin /Applications/MAMP/bin/php5/bin/php appears to have a suffix 5/bin/php, but config variable php_suffix does not match running: phpize Configuring for: PHP Api Version: 20041225 Zend Module Api No: 20060613 Zend Extension Api No: 220060519 Enable memcache session handler support? [yes] : yes ... Build process completed successfully Installing '/Applications/MAMP/bin/php5/lib/php/extensions/no-debug-non-zts-20060613/memcache.so' install ok: channel://pecl.php.net/memcache-2.2.5 configuration option "php_ini" is not set to php.ini location You should add "extension=memcache.so" to php.ini

    Read the article

  • Database OR Array

    - by rezoner
    What is the exact point of using external database system if I have simple relations (95% querries are dependant on ID). I am storing users and their stats. Why would I use external database if I can have neat constructions like: db.users[32] = something Array of 500K users is not that big effort for RAM Pros are: no problematic asynchronity (instant results) easy export/import dealing with database like with a native object LITERALLY ps. and considerations: Would it be faster or slower to do collection[3] than db.query("select ... I am going to store it as a file/s There is only ONE application/process accessing this data, and the code is executed line by line - please don't elaborate about locking. Please don't answer with database propositions but why to use external DB over native array/object - I have experience in a few databases - that's not the case. What I am building is a client/gateway/server(s) game. Gateway deals with all users data, processing, authenticating, writing statistics e.t.c No other part of software needs to access directly to this data/database.

    Read the article

  • Set up Glassfish connection pool to talk to a database on a Ubuntu VPS

    - by Harry Pham
    On my Ubuntu VPS, i have a mysql server running and a Glassfish 3.0.1 Application Server running. And I am having a hard to have my GF successfully ping the database. Here is my GF set up Assume: x.y.z.t is the ip of my VPS Resource Type: javax.sql.ConnectionPoolDataSource User: root DatabaseName: scholar Url: jdbc:mysql://x.y.z.t:3306/scholar URL: jdbc:mysql://x.y.z.t:3306/scholar Password: xxxx PortNumber: 3306 ServerName: x.y.z.t Inside my glassfish3/glassfish/lib, I have my mysql-connector-java-5.1.13-bin.jar Inside the database, table mysql here is the result of the query select User, Host from user; +------------------+-----------+ | User | Host | +------------------+-----------+ | root | 127.0.0.1 | | debian-sys-maint | localhost | | root | localhost | | root | yunaeyes | +------------------+-----------+ Now from my machine, if I try to connect to this db via mysql browser (mysql client software), well I cant. Well from the table above, seem like it only allow localhost to connect to this db. Keep in mind that both my db and my GF are on the same VPS. Please help

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution EDIT I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • How to proxy to different named databases on the same server using MySQL Proxy?

    - by cclark
    I would like to have two databases on my MySQL server: DEV_DB_A DEV_DB_B However, in order to keep everyone's scripts, Query Browser settings and anything else from changing when we switch from using on DB to another I'd like to have everyone connect to DEV_DB and then use something like MySQL Proxy running a lua script which knows the currently active DB is DEV_DB_A and routes queries to there. If we restore a fresh version of the DB to DEV_DB_B or make some changes (e.g. partition a table) we can easily switch to DEV_DB_B by changing one Lua script instead of updating references everywhere. I had hoped I might be able to symlink inside of the mysql data directory but that didn't work so it seems like MySQL Proxy is a reasonable approach. Being new to Lua and MySQL Proxy I'm wondering if anyone else has approached the problem this way and how it worked.

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • Multiple client connecting to master MySQL over SSL

    - by Bastien974
    I successfully configured a MySQL replication over SSL between 2 servers accross the internet. Now I want a second server in the same location as the replication slave, to open a connection to the master db over ssl. I used the same command found here http://dev.mysql.com/doc/refman/5.1/en/secure-create-certs.html to generate a new set of client-cert.pem and client-key.pem with the same master db ca-cert/key.pem and I also used a different Common Name. When I try to initiate a connection between this new server and the master db, it fails : mysql -hmasterdb -utestssl -p --ssl-ca=/var/lib/mysql/newcerts/ca-cert.pem --ssl-cert=/var/lib/mysql/newcerts/client-cert.pem --ssl-key=/var/lib/mysql/newcerts/client-key.pem ERROR 2026 (HY000): SSL connection error It's working without SSL.

    Read the article

  • Hyper-V cluster VS regular cluster

    - by Sasha
    We need to choice between Hyper-V and regular cluster technologies. What is the advantage and disadvantage of these approaches? Update: We have to physical servers and want to build reliably solution using cluster approach. We need to clustering our application and DB (MS SQL). We know that we can use: Regular Windows Cluster Service. Application and DB will be migrating from one node to other. Hyper-V Failover Cluster. Virtual machine will be migrating from one node to other. Combined variant. DB mirroring for MS SQL and Hyper-V for our application. We need to make a choice between this approach. So we need to know advantage and disadvantage of these approaches?

    Read the article

  • Migrating data from Oracle database to Pervasive .DAT files

    - by kaychaks
    The requirement is to migrate some tables with data from a Oracle database server to Pervasive database's .DAT file. Then those .DAT files will be used by a Pervasive database server. The restriction is that Oracle DB can not directly migrate to the Pervasive DB. It has to generate the .DAT files and then the new .DAT files will replace the old one for the Pervasive DB which will then use them for the new data. I was trying this task with SSIS. Exporting the Oracle table to a delimited .txt file and then creating a .DAT file from that text file. I can export the data from Oracle to .txt but I am not finding any way to migrate .txt to Pervasive .DAT? Is this the right approach? If not then please help with my problem.

    Read the article

  • How to install pecl uploadprogress on Debian Lenny

    - by kidrobot
    I am getting this output/error for # pecl install uploadprogress downloading uploadprogress-1.0.1.tgz ... Starting to download uploadprogress-1.0.1.tgz (8,536 bytes) .....done: 8,536 bytes 4 source files, building running: phpize Configuring for: PHP Api Version: 20041225 Zend Module Api No: 20060613 Zend Extension Api No: 220060519 building in /var/tmp/pear-build-root/uploadprogress-1.0.1 running: /tmp/pear/temp/uploadprogress/configure checking for grep that handles long lines and -e... /bin/grep checking for egrep... /bin/grep -E checking for a sed that does not truncate output... /bin/sed checking for gcc... no checking for cc... no checking for cl.exe... no configure: error: no acceptable C compiler found in $PATH See `config.log' for more details. ERROR: `/tmp/pear/temp/uploadprogress/configure' failed php-pear is installed. I'm stumped.

    Read the article

  • Cannot install Pecl (Imagick) extension on Centos server - autoconf missing

    - by Stevo
    I'm trying to install the pecl extension Imagick on a centos server, but I'm getting an error about autoconf. Autoconf is installed, as is make and gcc. but it's complaining about the path: [root@server ~]# pecl install imagick downloading imagick-3.0.1.tgz ... Starting to download imagick-3.0.1.tgz (93,920 bytes) .....................done: 93,920 bytes 13 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 /usr/bin/phpize: /var/tmp/imagick/build/shtool: /bin/sh: bad interpreter: Permission denied Cannot find autoconf. Please check your autoconf installation and the $PHP_AUTOCONF environment variable. Then, rerun this script. ERROR: `phpize' failed What should I do?

    Read the article

  • DBD::mysql gives mysql_init not found

    - by highBandWidth
    I have to install a non-admin copy of mysql and perl module DBD::mysql in my home directory. I installed mysql in ~/software/db/mysql and this works since I can start and stop the server and go to the mysql prompt. Then, I downloaded the perl module and installed it using perl Makefile.PL PREFIX=~/myperl/ LIB=~/myperl/lib/lib64/perl5/ --mysql_config=/my_home/software/db/mysql/bin/mysql_config --libs=/myhome/software/db/mysql/lib/libmysqlclient.a make make install I did this to use the statically linked mysql client library. perl -MDBD::mysql -e 1 gives no errors. However, when I actually try to use the module, I get /usr/bin/perl: symbol lookup error: /myhome/myperl/lib/lib64/perl5/x86_64-linux-thread-multi/auto/DBD/mysql/mysql.so: undefined symbol: mysql_init

    Read the article

  • php5-fpm.sock file doesn't exist

    - by Caballero
    I've just compiled and installed PHP-FPM 5.5.5 following this tutorial. I have ignored the apache setup section, because I'm running nginx. Everything seems to be fine: php -v PHP 5.5.5 (cli) (built: Oct 18 2013 21:56:02) Copyright (c) 1997-2013 The PHP Group Zend Engine v2.5.0, Copyright (c) 1998-2013 Zend Technologies Problem is, I need to link it to my nginx conf via a socket, but /var/run/php5-fpm.sock file doesn't exist. How do I create it? The file /etc/php5/fpm/pool.d/www.conf does include the line listen = /var/run/php5-fpm.sock It is possible (though I'm not sure) that it's a leftover of an older php version 5.5.3 which was installed and removed via apt-get. I'm running Ubuntu 13.10 (Saucy Salamander)

    Read the article

  • Updating PHP on a Plesk managed Server

    - by mblaettermann
    I just updated PHP and MySQl on my VPS with the current Versions from Atomic Repo. Everything worked out fine so far. From console I get the new PHP 5.3: [root@server phpMyAdmin]# php -v PHP 5.3.16 (cli) (built: Aug 20 2012 11:18:05) Copyright (c) 1997-2012 The PHP Group Zend Engine v2.3.0, Copyright (c) 1998-2012 Zend Technologies with the ionCube PHP Loader v4.0.5, Copyright (c) 2002-2011, by ionCube Ltd. But through Apache I still get the old version (5.1.6). The server is running some old version of crappy Plesk Panel. That gives me the option to choose between Apache Modul, fCGI and CGI-BIN. Any hints, how to update apache, so it will use the new PHP Version? EDIT: I just needed to restart httpd (/etc/init.d/httpd restart)

    Read the article

  • PID:4 using Port 80

    - by CyberOPS
    I was trying to install Zend Server CE on my computer but when I got to the point were I need to choose the port for my Web Server it says: "Web Server Port: 80 Occupied". So I decided to check what is using Port 80 with CMD by typing: "netstat -o -n -a | findstr 0.0:80": TCP 0.0.0.0:80 0.0.0.0:0 LISTENING 4 I check for PID:4 in Task Manager's Processes and Services. Seems PID 4 is "System". So, what I want to know is how can I stop "System" (PID:4) from using Port 80? INFO: I am using: Windows 7 64bit; Zend Server CE 5.5.0

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • Setting up a server with only subdomains, any connection to top level goes to main server on another IP?

    - by Anagio
    I'm developing a web app where users will have their own sub-domain to login to and use the application. I'm running wordpress for the main website to manage the public / front end. Our application is developed in zend framework. The zf project is currently in a subfolder on the main server. I'd like to place the zend framework project onto another server (different IP) and keep it separate from the the wordpress front end www.domain.com site. The zf application server will run nginx. I'm not sure how to setup a server to run strictly sub domains. Setting up the virtual hosts in the configuration file is no problem. To give the users username.domain.com. But what about the main default configuration file? How would that be configured since the top level domain is technically another server (wordpress) on another IP?

    Read the article

  • Backup all plesk MySQL Databases to individual files

    - by Michael
    Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 126 127 128 129 130 131 132 133 134 135 136 137  | Next Page >