Search Results

Search found 17448 results on 698 pages for 'regular expressions info'.

Page 135/698 | < Previous Page | 131 132 133 134 135 136 137 138 139 140 141 142  | Next Page >

  • ESXi with non-headless VM

    - by Mike
    I'm going to receive a Xeon Server/Workstation soon and I was thinking about installing ESXi to host some server applications that I want (ex: SVN server, Web server, media server, etc). Most of these will be headless VM's. My question is: on top of all these headless VM's, is it possible for ESXi to have another VM that would be non-headless (so that it will output video through the VGA/DVI port)? Or are all VM's within ESXi only accessible through remote connections? I'll be using this non-headless VM like a regular workstation: browsing, development, media, gaming maybe. The other alternative I was thinking about is to install a very lightweight operating system and have the headless VM's running in Virtualbox. If it is possible to have have a non-headless VM, what would be the performance compared to a regular workstation? Noticeable or not when gaming?

    Read the article

  • How Can I Log and Find the Most Expensive Queries?

    - by Pure.Krome
    Hi folks The activity monitor in sql2k8 allows us to see the most expensive queries. Ok, that's kewl, but is there a way I can log this info or get this info via query analyser? I don't really want to have the Sql Management console open and me looking at the activity monitor dashboard. I want to figure out which queries are poorly written/schema is poorly designed, etc. Thanks heaps for any help!

    Read the article

  • How to remove control chars from UTF8 string

    - by Mimefilt
    Hi there, i have a VB.NET program that handles the content of documents. The programm handles high volumes of documents as "batch"(2Million documents;total 1TB volume) Some of this documents may contain control chars or chars like f0e8(http://www.fileformat.info/info/unicode/char/f0e8/browsertest.htm). Is there a easy and especially fast way to remove that chars?(except space,newline,tab,...) If the answer is regex: Has anyone a complete regex for me? Thanks!

    Read the article

  • Is it possible to add IPTC data to a JPG using python when no such data already exists?

    - by ventolin
    With the IPTCInfo module under Python (http://snippets.dzone.com/posts/show/768 for more info) it's possible to read, modify and write IPTC info to pictures. However, if a JPG doesn't already have IPTC information, the module simply raises an exception. It doesn't seem to be able to create and add this metadata information itself. What alternatives are there? I've googled for the past hour but to no avail whatsoever.

    Read the article

  • wpf mvvm client server application

    - by jim
    First of all i must say i am new to wpf and mvvm. I want to develop a client-server application(clients send info to the server and the serer notifies one or more of them..consider something like yahoo messenger(some user changes his status..sends info to the server and the sever notifies his friends and changes to their UI are made) My question is: does mvvm suits well with this kind of application?

    Read the article

  • How do I remove Windows Update uninstall files on Windows Server 2008?

    - by Robert Koritnik
    I'm running Windows Server 2008 Standard running in VMware. It has 2 disks: system disk: 16 GB data disk: 500 MB I installed Visual Studio 2008 SP1 + MSDN and some small tools and libraries that don't take much space. Over time the system disk's free space has been going down (I suspect because of regular system updates - NetFx (.NET), service packs, and regular updates). Questions 1 How do you remove Windows Update uninstall files from Windows Server 2008? Question 2 I also found lots of files in C:/Windows/Installer folder. Is it possible to determine which .msp file goes with which patch? I would like to delete some of them, because they do take a lot of space.

    Read the article

  • Yahoo toolbar and local sites (e.g. Intranet)

    - by Klaptrap
    We have local sites running on IIS in regular MS Windows network. User base has IE, FireFox and Chrome. Local sites are isolated by host headers and DNS record created for the common IP accordingly. This is a regular set-up. Users without Yahoo Toolbar type http://intranet and the sites resolves. Users with Yahoo toolbar type http://intranet and the toolbar goes off to search for this site in public domain. This is irrespective to whether the address is typed into the browser address bar or the toolbar. All versions of toolbar and IE are affected. I cannot see a setting on the toolbar to switch this "irritating" behaviour off and simply un-installing the toolbar is not an option. Any ideas?

    Read the article

  • Case in-sensitivity for Apache httpd Location directive

    - by user57178
    I am working with a solution that requires the usage of mod_proxy_balancer and an application server that both ignores case and mixes different case combinations in URLs found in generated content. The configuration works, however I have now a new requirement that causes problems. I should be able to create a location directive (as per http://httpd.apache.org/docs/current/mod/core.html#location ) and have the URL-path interpret in case insensitive mode. This requirement comes from the need to add authentication directives to the location. As you might guess, users (or the application in question) changing one letter to capital circumvents the protection instantly. The httpd runs on Unix platform so every configuration directive is apparently case sensitive by default. Should the regular expressions in the Location directive work in this case? Could someone please show me an example of such configuration that should work? In case a regular expression can not be forced to work case insensitively, what part of httpd's source code should I go around modifying?

    Read the article

  • Strange behavior: save video recorded within app?

    - by Josue Espinosa
    I allow the user to record a video within my app, then later play it again. When a user records a video, I save the URL of the video, then play the video later from the saved URL. I save the video both in the Photos app and in my app. If I delete the video within the photos app, it still plays. After about 7 days, the video gets deleted. I think I am saving in my tmp directory, but i'm not sure. Here is what I am doing: -(void)imagePickerController:(UIImagePickerController *)picker didFinishPickingMediaWithInfo:(NSDictionary *)info { NSString *mediaType = [info objectForKey: UIImagePickerControllerMediaType]; [self dismissViewControllerAnimated:YES completion:nil]; // Handle a movie capture if (CFStringCompare ((__bridge_retained CFStringRef) mediaType, kUTTypeMovie, 0) == kCFCompareEqualTo) { NSString *moviePath = [NSString stringWithFormat:@"%@",[[info objectForKey:UIImagePickerControllerMediaURL] path]]; NSURL *videoURL = [info objectForKey:UIImagePickerControllerMediaURL]; NSData *videoData = [NSData dataWithContentsOfURL:videoURL]; _justRecordedVideoURL = [NSString stringWithFormat:@"%@",videoURL]; AppDelegate *appDelegate = [[UIApplication sharedApplication] delegate]; _managedObjectContext = [appDelegate managedObjectContext]; Video *video = [NSEntityDescription insertNewObjectForEntityForName:@"Video" inManagedObjectContext:_managedObjectContext]; [video setVideoData:videoData]; [video setVideoURL:[NSString stringWithFormat:@"%@",videoURL]]; NSDateFormatter *dateFormatter = [[NSDateFormatter alloc] init]; dateFormatter.dateStyle = NSDateFormatterLongStyle; [dateFormatter setDateStyle:NSDateFormatterLongStyle]; NSDate *date = [dateFormatter dateFromString:[dateFormatter stringFromDate:[NSDate date]]]; NSString *dateAdded = [dateFormatter stringFromDate:date]; [video setDate_recorded:dateAdded]; if(_currentAthlete != nil){ [video setWhosVideo:_currentAthlete]; } NSError *error = nil; if(![_managedObjectContext save:&error]){ //handle dat error } NSArray *paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectory = [paths objectAtIndex:0]; NSString *tempPath = [documentsDirectory stringByAppendingFormat:@"/vid1.mp4"]; BOOL success = [videoData writeToFile:tempPath atomically:NO]; if(success == FALSE){ NSLog(@"Video was not successfully saved."); } if (UIVideoAtPathIsCompatibleWithSavedPhotosAlbum(moviePath)) { UISaveVideoAtPathToSavedPhotosAlbum(moviePath, self, @selector(video:didFinishSavingWithError:contextInfo:), nil); } } } Am I saving it incorrectly? When I go to play the video, it works fine, after a couple days the video will play without audio, then eventually it will be gone. Any ideas why?

    Read the article

  • How many hours of use before I need to clean a tape drive?

    - by codeape
    I do backups to a HP Ultrium 2 tape drive (HP StorageWorks Ultrium 448). The drive has a 'Clean' LED that supposedly will light up or blink when the drive needs to be cleaned. The drive has been in use since october 2005, and still the 'Clean' light has never been lit. The drive statistics are: Total hours in use: 1603 Total bytes written: 19.7 TB Total bytes read: 19.3 TB My question is: How many hours of use can I expect before I need to clean the drive? Edit: I have not encountered any errors using the drive. I do restore tests every two months, and every backup is verified. Edit 2: The user manual says: "HP StorageWorks Ultrium tape drives do not require regular cleaning. An Ultrium universal cleaning cartridge should only be used when the orange Clean LED is flashing." Update: It is now May 2010 (4.5 years of use), and the LED is still off, I have not cleaned, backups verify and regular restore tests are done.

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose? [migrated]

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • My UITabBarController isn't appearing, but its first view is?

    - by E-Madd
    I've done some reorganizing of my project recently and now I'm not seeing my tab bar controller, but its first view controller's view is appearing. Here's a breakdown of everything that happens prior to the problem. App Delegate loads FirstViewController with nib. FirstViewController loads the application data from my server and then presents MainViewController with a modal transition. MainViewController is where the UITabBarController is supposed to be appearing. It's a very simple class. The .h @interface MainViewController : UIViewController <UITabBarControllerDelegate> { IBOutlet UITabBarController *tabBarController; } @property (nonatomic, retain) UITabBarController *tabBarController; @end The .m @implementation MainViewController @synthesize tabBarController; - (void)viewDidLoad { NSLog(@"MainViewController viewDidLoad"); //set tab bar controller delegate to self tabBarController.delegate = self; // home view HomeViewController *home = [[HomeViewController alloc] initWithTab]; // menu view MenuViewController *menu = [[MenuViewController alloc] initWithTab]; // special offers view SpecialOffersViewController *so = [[SpecialOffersViewController alloc] initWithTab]; // events view EventsViewController *events = [[EventsViewController alloc] initWithTab]; // info view InfoViewController *info = [[InfoViewController alloc] initWithTab]; //populate the tab bar controller with view controllers NSArray *controllers = [NSArray arrayWithObjects:home, menu, so, events, info, nil]; tabBarController.viewControllers = controllers; //release view controllers [home release]; [menu release]; [so release]; [events release]; [info release]; [controllers release]; //add tab bar controller to view [self.view addSubview:tabBarController.view]; [super viewDidLoad]; } and here's the bit from FirstViewController that modally presents the MainViewController... MainViewController *controller = [[MainViewController alloc] initWithNibName:@"MainViewController" bundle:nil]; controller.modalTransitionStyle = UIModalTransitionStyleFlipHorizontal; [self presentModalViewController:controller animated:YES]; [controller release]; I'm not getting any compiler errors or warnings and the app runs swell... no crashing. It just isn't showing the darned TabBar, and it used to when I was creating it on my AppDelegate. I checked everything in my NIB and my outlets seem to be hooked up ok. I have no idea what's happened. Help!

    Read the article

  • accessing SQL syntax reference in mysql workbench

    - by dcompiled
    Finding it a little bit tedious migrating to the new Mysql Workbench (5.2.22) even though it has many more features than the older GUI tools. Right now I'm confused why I can't find an SQL reference when I open the Doc Library. Is there a way to access this info within the workbench, I'd prefer not to have to open a browser to access reference info on the web.

    Read the article

  • StreamWriter appends random data

    - by void
    Hi I'm seeing odd behaviour using the StreamWriter class writing extra data to a file using this code: public void WriteToCSV(string filename) { StreamWriter streamWriter = null; try { streamWriter = new StreamWriter(filename); Log.Info("Writing CSV report header information ... "); streamWriter.WriteLine("\"{0}\",\"{1}\",\"{2}\",\"{3}\"", ((int)CSVRecordType.Header).ToString("D2", CultureInfo.CurrentCulture), m_InputFilename, m_LoadStartDate, m_LoadEndDate); int recordCount = 0; if (SummarySection) { Log.Info("Writing CSV report summary section ... "); foreach (KeyValuePair<KeyValuePair<LoadStatus, string>, CategoryResult> categoryResult in m_DataLoadResult.DataLoadResults) { streamWriter.WriteLine("\"{0}\",\"{1}\",\"{2}\",\"{3}\"", ((int)CSVRecordType.Summary).ToString("D2", CultureInfo.CurrentCulture), categoryResult.Value.StatusString, categoryResult.Value.Count.ToString(CultureInfo.CurrentCulture), categoryResult.Value.Category); recordCount++; } } Log.Info("Writing CSV report cases section ... "); foreach (KeyValuePair<KeyValuePair<LoadStatus, string>, CategoryResult> categoryResult in m_DataLoadResult.DataLoadResults) { foreach (CaseLoadResult result in categoryResult.Value.CaseLoadResults) { if ((LoadStatus.Success == result.Status && SuccessCases) || (LoadStatus.Warnings == result.Status && WarningCases) || (LoadStatus.Failure == result.Status && FailureCases) || (LoadStatus.NotProcessed == result.Status && NotProcessedCases)) { streamWriter.Write("\"{0}\",\"{1}\",\"{2}\",\"{3}\",\"{4}\"", ((int)CSVRecordType.Result).ToString("D2", CultureInfo.CurrentCulture), result.Status, result.UniqueId, result.Category, result.ClassicReference); if (RawResponse) { streamWriter.Write(",\"{0}\"", result.ResponseXml); } streamWriter.WriteLine(); recordCount++; } } } streamWriter.WriteLine("\"{0}\",\"{1}\"", ((int)CSVRecordType.Count).ToString("D2", CultureInfo.CurrentCulture), recordCount); Log.Info("CSV report written to '{0}'", fileName); } catch (IOException execption) { string errorMessage = string.Format(CultureInfo.CurrentCulture, "Unable to write XML report to '{0}'", fileName); Log.Error(errorMessage); Log.Error(exception.Message); throw new MyException(errorMessage, exception); } finally { if (null != streamWriter) { streamWriter.Close(); } } } The file produced contains a set of records on each line 0 to N, for example: [Record Zero] [Record One] ... [Record N] However the file produced either contains nulls or incomplete records from further up the file appended to the end. For example: [Record Zero] [Record One] ... [Record N] [Lots of nulls] or [Record Zero] [Record One] ... [Record N] [Half complete records] This also happens in separate pieces of code that also use the StreamWriter class. Furthermore, the files produced all have sizes that are multiples of 1024. I've been unable to reproduce this behaviour on any other machine and have tried recreating the environment. Previous versions of the application didn't exhibite this behaviour despite having the same code for the methods in question. EDIT: Added extra code.

    Read the article

  • awk or sed: Best way to grab [this text]

    - by Parand
    I'm trying to parse various info from log files, some of which is placed within square brackets. For example: Tue, 06 Nov 2007 10:04:11 INFO processor:receive: [someuserid], [somemessage] msgtype=[T] What's an elegant way to grab 'someuserid' from these lines, using sed, awk, or other unix utility?

    Read the article

  • Free java or flash file browser for photogallery

    - by Christian
    Hi. I'm about to develop a small web gallery, where it's supposed to be possible to upload several pictures at a time and then add some info abut the pictures.So I need a free java or flash local file browser that can pass me some info of the pictures that gets uploaded so that I can create some SQL entries for each picture. The platform for the project will be PHP and MySQL. Any good recommendations?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose?

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • How to change file contents in PHP ?

    - by Misha Moroshko
    I save in a file some info about users (like number of times user passed the login page, last visited time, and so on). I want to read this info from the file, and update it (add 1 to the counter, and change the last visited time). My question is: can I do it without opening the file twice ? I open the first time to read the contents, and then open it again to overwrite the contents with the updated ones. Thanks !

    Read the article

  • Do you think Microsoft is finally on the right track with its Windows 7?

    - by Saif Bechan
    It has been a while now since Windows 7 has been released. So far I didn't hear of many major complaints about it. I can remember the time that Windows Vista hist the shelves. There were major complaints from both experts and just regular users. I do a lot of OS installs for just regular users. These are mostly family and friends, and sometimes there are some customers. Up till now I mostly still use Windows XP SP3, because it is stable and most people are familiar with it. I did Vista for some users but they always call me back with all sorts of questions and in the end I had to downgrade them to XP. Do you think it is safe now to recommend Windows 7 as a good operating system? Offcourse their hardware has to support it, but let's say that is the case. If you install Windows 7 a lot for people, what are the complaints about if you get them?

    Read the article

  • Dragging a image in flex

    - by johnraja
    Hi I am having trouble in dragging a image within a loader. I am able to do zooming and rotating image but not moving image with mouse. Purpose is when I zoom a image info is out of boundaries and so is hidden. To see that info users should be able to drag the image any way they want. Please help.

    Read the article

< Previous Page | 131 132 133 134 135 136 137 138 139 140 141 142  | Next Page >