Search Results

Search found 4848 results on 194 pages for 'expression blend 4'.

Page 138/194 | < Previous Page | 134 135 136 137 138 139 140 141 142 143 144 145  | Next Page >

  • SImplifying with LINQ - Basic selection

    - by baron
    Hello foreach (var person in peopleList.Where(person => person.FirstName == "Messi")) { selectPeople.Add(person); } I am just wondering if there is any way to simplify this using LINQ. Like rather than look at all the people I was trying to use LINQ to just fill a list with the "Messi"'s... was trying something like... var selectPeople = peopleList.Select(x=>x.FirstName=="Messi"); Then I could just add everyone in that list without a check. But it doesn't quite work as planned. Maybe there's no point simplifying that expression. But the question seemed worthwhile just to strengthen my LINQ knowledge.

    Read the article

  • Regex to validate SMTP Responses?

    - by Alix Axel
    I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

    Read the article

  • ASP.NET GridView sorting on method data

    - by husainnz
    Hi, I'm binding a GridView to a domain model object, this domain model object has a method for working out a formatted value to display on the grid. I'd like to use this method for my display value, which is fine, but I'd also like to be able to sort on the value returned by that method. My sort expression can only take in a property/field at the moment. Help please! What do I need to do to get this to work? I'm using an SPGridView actually, but that doesn't make a lot of difference to my problem. Thanks.

    Read the article

  • Why won't binding to a child object property with rdlc Report work in vs2010?

    - by andrej351
    A while ago someone asked how to bind to a child object's property in a rdlc report. Question here. The solution was to use an expression like this: =Fields!ChildObject.Value.SomeProperty I have recently tried to upgrade to version 10 of the reporting libraries (Microsoft.ReportViewer.WebForms and Microsoft.ReportViewer.Common) and for some reason this does not work anymore. I have got the report rendering and displaying all data fine except any which uses this technique. Instead of the property value i get the text: "#Error" Why doesn't this work anymore? Anybody know how to to this in the new version?

    Read the article

  • Center a TextBox over the top of a ScrollViewer in WPF.

    - by Eric
    I have a MainView that contains a navigation bar which selects one of many XAML pages to be displayed in the page view pane. The MainView contains a ScrollViewer around the pages. This allows the pages to be whatever size they need to be and the MainView's ScrollViewer scrolls them. This all works great. On one of the pages, I need to (sometimes) center a TextBox in the middle of the page view pane (over the top of the page content). This was easily done by placing both the page content and the TextBox overlapping each other in a Grid (and I hide the TextBox as necessary). This all seems to work great. However, if the page content grows to be larger than the pane, the TextBox is centered not on the pane, but on the full page content. Thus, it moves from center screen down and/or to the right (and eventually off the screen). Bummer. Options: Remove the ScrollViewer from the MainView. This would require placing one on every page! Argh. Do option #1, and create a ScrolledPage base class. This is a lot of work, and I'm worried about tools issues (Blend issues). It also requires changing every page (to subclass this page). Somehow override the ScrollViewer on just this page. Then, place another ScrollViewer on the page content to Scroll it. Option 3 seems preferable, because it contains the issue to just modifying this page (instead of changing the rest of the pages). However, I can't figure out how to do it. Ideas? Thanks in advance! Eric

    Read the article

  • Get latest sql rows based on latest date and per user

    - by Umair
    I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • Double-Escaped Unicode Javascript Issue

    - by Jeffrey Winter
    I am having a problem displaying a Javascript string with embedded Unicode character escape sequences (\uXXXX) where the initial "\" character is itself escaped as "&#92;" What do I need to do to transform the string so that it properly evaluates the escape sequences and produces output with the correct Unicode character? For example, I am dealing with input such as: "this is a &#92;u201ctest&#92;u201d"; attempting to decode the "&#92;" using a regex expression, e.g.: var out = text.replace('/&#92;/g','\'); results in the output text: "this is a \u201ctest\u201d"; that is, the Unicode escape sequences are displayed as actual escape sequences, not the double quote characters I would like.

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Is the Windows dev environment worth the cost?

    - by MCS
    I recently made the move from Linux development to Windows development. And as much of a Linux enthusiast that I am, I have to say - C# is a beautiful language, Visual Studio is terrific, and now that I've bought myself a trackball my wrist has stopped hurting from using the mouse so much. But there's one thing I can't get past: the cost. Windows 7, Visual Studio, SQL Server, Expression Blend, ViEmu, Telerik, MSDN - we're talking thousands for each developer on the project! You're definitely getting something for your money - my question is, is it worth it? [Not every developer needs all the aforementioned tools - but have you ever heard of anyone writing C# code without Visual Studio? I've worked on pretty large software projects in Linux without having to pay for any development tool whatsoever.] Now obviously, if you're already a Windows shop, it doesn't pay to retrain all your developers. And if you're looking to develop a Windows desktop app, you just can't do that in Linux. But if you were starting a new web application project and could hire developers who are experts in whatever languages you want, would you still choose Windows as your development platform despite the high cost? And if yes, why?

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • background image not showing in html

    - by Registered User
    I am having following css <!DOCTYPE html > <html> <head> <meta charset="utf-8"> <title>Black Goose Bistro Summer Menu</title> <link href='http://fonts.googleapis.com/css?family=Marko+One' rel='stylesheet' type='text/css'> <style> body { font-family: Georgia, serif; font-size: 100%; line-height: 175%; margin: 0 15% 0; background-image:url(images/bullseye.png); } #header { margin-top: 0; padding: 3em 1em 2em 1em; text-align: center; } a { text-decoration: none; } h1 { font: bold 1.5em Georgia, serif; text-shadow: .1em .1em .2em gray; } h2 { font-size: 1em; text-transform: uppercase; letter-spacing: .5em; text-align: center; } dt { font-weight: bold; } strong { font-style: italic; } ul { list-style-type: none; margin: 0; padding: 0; } #info p { font-style: italic; } .price { font-family: Georgia, serif; font-style: italic; } p.warning, sup { font-size: small; } .label { font-weight: bold; font-variant: small-caps; font-style: normal; } h2 + p { text-align: center; font-style: italic; } ); </style> </head> <body> <div id="header"> <h1>Black Goose Bistro &bull; Summer Menu</h1> <div id="info"> <p>Baker's Corner, Seekonk, Massachusetts<br> <span class="label">Hours: Monday through Thursday:</span> 11 to 9, <span class="label">Friday and Saturday;</span> 11 to midnight</p> <ul> <li><a href="#appetizers">Appetizers</a></li> <li><a href="#entrees">Main Courses</a></li> <li><a href="#toast">Traditional Toasts</a></li> <li><a href="#dessert">Dessert Selection</a></li> </ul> </div> </div> <div id="appetizers"> <h2>Appetizers</h2> <p>This season, we explore the spicy flavors of the southwest in our appetizer collection.</p> <dl> <dt>Black bean purses</dt> <dd>Spicy black bean and a blend of mexican cheeses wrapped in sheets of phyllo and baked until golden. <span class="price">$3.95</span></dd> <dt class="newitem">Southwestern napoleons with lump crab &mdash; <strong>new item!</strong></dt> <dd>Layers of light lump crab meat, bean and corn salsa, and our handmade flour tortillas. <span class="price">$7.95</span></dd> </dl> </div> <div id="entrees"> <h2>Main courses</h2> <p>Big, bold flavors are the name of the game this summer. Allow us to assist you with finding the perfect wine.</p> <dl> <dt class="newitem">Jerk rotisserie chicken with fried plantains &mdash; <strong>new item!</strong></dt> <dd>Tender chicken slow-roasted on the rotisserie, flavored with spicy and fragrant jerk sauce and served with fried plantains and fresh mango. <strong>Very spicy.</strong> <span class="price">$12.95</span></dd> <dt>Shrimp sate kebabs with peanut sauce</dt> <dd>Skewers of shrimp marinated in lemongrass, garlic, and fish sauce then grilled to perfection. Served with spicy peanut sauce and jasmine rice. <span class="price">$12.95</span></dd> <dt>Grilled skirt steak with mushroom fricasee</dt> <dd>Flavorful skirt steak marinated in asian flavors grilled as you like it<sup>*</sup>. Served over a blend of sauteed wild mushrooms with a side of blue cheese mashed potatoes. <span class="price">$16.95</span></dd> </dl> </div> <div id="toast"> <h2>Traditional Toasts</h2> <p>The ultimate comfort food, our traditional toast recipes are adapted from <a href="http://www.gutenberg.org/files/13923/13923-h/13923-h.htm"><cite>The Whitehouse Cookbook</cite></a> published in 1887.</p> <dl> <dt>Cream toast</dt> <dd>Simple cream sauce over highest quality toasted bread, baked daily. <span class="price">$3.95</span></dd> <dt>Mushroom toast</dt> <dd>Layers of light lump crab meat, bean and corn salsa, and our handmade flour tortillas. <span class="price">$6.95</span></dd> <dt>Nun's toast</dt> <dd>Onions and hard-boiled eggs in a cream sauce over buttered hot toast. <span class="price">$6.95</span></dd> <dt>Apple toast</dt> <dd>Sweet, cinnamon stewed apples over delicious buttery grilled bread. <span class="price">$6.95</span></dd> </dl> </div> <div id="dessert"> <h2>Dessert Selection</h2> <p>Be sure to save room for our desserts, made daily by our own <a href="http://www.jwu.edu/college.aspx?id=19510">Johnson & Wales</a> trained pastry chef.</p> <dl> <dt class="newitem">Lemon chiffon cake &mdash; <strong>new item!</strong></dt> <dd>Light and citrus flavored sponge cake with buttercream frosting as light as a cloud. <span class="price">$2.95</span></dd> <dt class="newitem">Molten chocolate cake</dt> <dd>Bubba's special dark chocolate cake with a warm, molten center. Served with or without a splash of almond liqueur. <span class="price">$3.95</span></dd> </dl> </div> <p class="warning"><sup>*</sup> We are required to warn you that undercooked food is a health risk.</p> </body> </html> but the background image does not appear in body tag you can see background-image:url(images/bullseye.png); this html page is bistro.html and the directory in which it is contained there is a folder images and inside images folder I have a file bullseye.png .I expect the png to appear in background.But that does not happen. For sake of question I am posting the image here also Let me know if the syntax of css wrong? following is image http://i.stack.imgur.com/YUKgg.png

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • problem with null column

    - by Iulian
    One column in my database (of type double) has some null values. I am executing a sored procedure to get the data in my app wipDBTableAdapters.XLSFacturiTableAdapter TAFacturi = new wipDBTableAdapters.XLSFacturiTableAdapter(); var dtfacturi = TAFacturi.GetData(CodProiect); Then i try to do something like this: if (dtfacturi[i].CANTITATE == null) { //do something } this is giving a warning : The result of the expression is always 'false' since a value of type 'double' is never equal to 'null' of type 'double? However when i run my code i get the following exception: StrongTypingException The value for column 'CANTITATE' in table 'XLSFacturi' is DBNull. How am I supposed to resolve this ?

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • How to get a fully transparent backbuffer in directx 9 without vista Desktop Window Manager

    - by flawlesslyfaulted
    I currently have an activex control that initiates a media (video/audio) framework another development group in my company developed and I am providing a window handle to that code. That handle is being used by their rendering plugin in the pipeline that uses Direct3d for rendering the video using that handle. I have seperate LPDIRECT3D9EX and LPDIRECT3DDEVICE9EX pointers that I initialize in my activex control. I am trying to clear a backbuffer to transparent and then use directx drawing primatives to draw on that backbuffer producing a transparent window with my drawing primatives over the streaming video on the directx surface below. It appears that clearing a device backbuffer with full alpha transparency is ignored by directx. d3ddev->Clear(0, NULL, D3DCLEAR_TARGET, D3DCOLOR_RGBA(0, 0, 1, 0 /*full alpha*/), 1.0f, 0); I can see the object I draw but they are drawn on top of a backbuffer that has the RGB color specified without the alpha value. The project linked (http://www.codeproject.com/KB/directx/umvistad3d.aspx) to in the stackoverflow question below does what I want but requires vista's Desktop Window Manager and won't work for XP. http://stackoverflow.com/questions/148275/how-do-i-draw-transparent-directx-content-in-a-transparent-window I have tried with D3DRS_ALPHABLENDENABLE true with configured blend with no avail. I have also tried to have pixels with full alpha values not rendered using D3DRS_ALPHATESTENABLE, D3DRS_ALPHAREF, and D3DRS_ALPHAFUNC setup but this doesn't work either. I have tried using ColorFill with alpha after retrieving the backbuffer with GetBackBuffer but this doesn't work either. (again only RGB is used) Finally I have tried creating a texture, selecting a surface, colorfilling that surface with a fully transparent alpha value, then loading that surface onto the backbuffer but only the RGB values appear to be used. I have checked the capabilities using the DXCapsViewer.exe and the D3DFMT_A8R8G8B8 backbuffer format that I am using for the backbuffer is valid so it can't be that. Has anyone gotten a transparent backbuffer in directx to work in XP?

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

< Previous Page | 134 135 136 137 138 139 140 141 142 143 144 145  | Next Page >