Search Results

Search found 1343 results on 54 pages for 'amit kumar jain'.

Page 14/54 | < Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >

  • How to accss memory location in Java?

    - by Abhishek Jain
    Is it possible that we can access memory location in Java directly or indirectly? If we tries to print a object, it will print hashcode. Does hashcode signify indirectly to memory location? For two object at different memory location but still their hashcode can varies. -Abhishek

    Read the article

  • Difference between weblogic and websphere?

    - by Abhishek Jain
    I do not find actual difference between these two J2EE server. From my past experience, I found out following: WL is evolving more faster than WAS. WL is more user friendly than WAS. To simply deploy a application in WAS, we need to go in deep and its difficult to find if u are new to it. I found out that WAS is slower in some machine than WL. I found out that Classloading is easier to understand and effective in WL than WAS Above all are my experiences but not actual facts. I want to know more in this respect. Please clear my doubts. If possible please provide each J2EE server's pros and cons. -Abhishek

    Read the article

  • minimal rsync installation on windows xp?

    - by Aman Jain
    Hi I want to install rsync on windows xp. I have searched the web, but most of the solutions suggest using cygwin, but is there any other way to do this? I don't want to install cygwin because it takes lot of space. Moreover, I need to make it communicate with a rsync daemon on Linux, therefore alternatives to rsync on windows won't help. Thanks

    Read the article

  • Jersey Rest : How to send Object to a Jersey Service class

    - by Preethi Jain
    I have this functionality in my Application implemented using Jersey Rest WebServices . Once the user is logged into the application , i am creating DTO Object and setting some User Specific Data inside it . Please let me know how can i pass this User Specific DTO Object to the Jersey Service class ?? Please note that , I dont want to use HttpSession to store Data (Because in our Application we have a facility where a User can enter with Multiple ID's in one browser as a result same sessionId will be created by the browser )

    Read the article

  • Issue while creating an android project with phonegap

    - by Mohit Jain
    When I try to create native android project in eclipse it works perfectly fine, and that shows my android setup is proper but when I try to create a phonegap project it create a error ie: ./create ~/Documents/workspace/HelloWorld com.fizzysoftware.HelloWorld HelloWorld BUILD FAILED /Users/mohit/Documents/eclipse/android-sdk-macosx/tools/ant/build.xml:710: The following error occurred while executing this line: /Users/mohit/Documents/eclipse/android-sdk-macosx/tools/ant/build.xml:723: Compile failed; see the compiler error output for details. Total time: 5 seconds An unexpected error occurred: ant jar > /dev/null exited with 1 Deleting project... cordova version: 2.7 Android api version 14 Ps: I am a ruby on rails developer. This is my day 1 with phonegap/android/ios

    Read the article

  • Import Contacts from .vcf file in Android 2.1

    - by Prateek Jain
    Hi All, I am able to retrieve all contacts from android in .vcf file using following code. ContentResolver cr = getContentResolver(); Cursor cur = cr.query(ContactsContract.Contacts.CONTENT_URI,null, null, null, null); String lookupKey = cur.getString(cur.getColumnIndex(ContactsContract.Contacts.LOOKUP_KEY)); Uri uri = Uri.withAppendedPath(ContactsContract.Contacts.CONTENT_VCARD_URI, lookupKey); System.out.println("The value is " + cr.getType(uri)); AssetFileDescriptor fd = this.getContentResolver().openAssetFileDescriptor(uri, "r"); FileInputStream fis = fd.createInputStream(); I don't know how to use this .vcf file to import all these contacts using code. The .vcf file contains all the details of all contacts including photos etc. Cheers, Prateek

    Read the article

  • ..../All Users/Application data folder permissions

    - by Amit Kumar Jain
    I have a windows desktop application whose application data is stored in the All Users/Application Data/ My Company folder. Now when I install my application on an Windows XP machine using an Administrator login. If I run my application using that administrator's login it works well but when I tried to run my application using a normal users login on that machine it fails. The reason for failure is that the normal user is not able to write anything in the All Users/Application data/ My Company folder. Now is any kind of permission is required for All Users folder on Windows XP machine. If yes then from where I can set that permission.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Example of ==, equals and hashcode in java

    - by Abhishek Jain
    Given this: String s1= new String("abc"); String s2= new String("abc"); String s3 ="abc"; System.out.println(s1==s3); System.out.println(s1==s2); System.out.println(s1.equals(s2)); System.out.println(s1.equals(s3)); System.out.println(s1.hashCode()); System.out.println(s2.hashCode()); System.out.println(s3.hashCode()); Output is: false false true true 96354 96354 96354 Here == is giving false for each object but hashcode for each String object is same. Why is it so?

    Read the article

  • Static and overriding in Java

    - by Abhishek Jain
    public class B { static int i =1; public static int multiply(int a,int b) { return i; } public int multiply1(int a,int b) { return i; } public static void main(String args[]) { B b = new A(); System.out.println(b.multiply(5,2)); System.out.println(b.multiply1(5,2)); } } class A extends B { static int i =8; public static int multiply(int a,int b) { return 5*i; } public int multiply1(int a,int b) { return 5*i; } } Output: 1 40 Why is it so? Please explain.

    Read the article

  • Pylons and Facebook

    - by Nayan Jain
    The following is my oauth template top.location.href='https://graph.facebook.com/oauth/authorize?client_id=${config['facebook.appid']}&redirect_uri=${config['facebook.callbackurl']}&display=page&scope=publish_stream'; Click here to authorize this application When I hit the page I am prompted to login (desired), upon login I am redirected in a loop between a permissions page and an app page. My controller looks like: class RootController(BaseController): def __before__(self): tmpl_context.user = None if request.params.has_key('session'): access_token = simplejson.loads(request.params['session'])['access_token'] graph = facebook.GraphAPI(access_token) tmpl_context.user = graph.get_object("me") def index(self): if not tmpl_context.user: return render('/oauth_redirect.mako') return render('/index.mako') I'm guessing my settings are off somewhere, probably with the callback. Not to sure if it is an issue with my code or the python sdk for facebook.

    Read the article

  • how to calculate total days from starting date to end date in c#,.net?

    - by Rishabh jain
    i m making a project in which i have to calculate total number of days from starting date to ending date which are inserted in text box by user at run time in asp.net c#.i have to do this on button_click event.how to do this? i tried this- protected void TextBox14_TextChanged(object sender, EventArgs e) { // get date from first text box DateTime dold = Convert.ToDateTime(TextBox1.Text); DateTime dnew = Convert.ToDateTime(TextBox14.Text); TimeSpan daydif = (dnew - dold); double dayd = daydif.TotalDays; Label27.Text = dayd.ToString(); }

    Read the article

  • How to upload image to remote server in iphone?

    - by Atulkumar V. Jain
    Hi Everybody, I am trying to upload a image which i am clicking with the help of the camera. I am trying the following code to upload the image to the remote server. -(void)searchAction:(UIImage*)theImage { UIDevice *dev = [UIDevice currentDevice]; NSString *uniqueId = dev.uniqueIdentifier; NSData * imageData = UIImagePNGRepresentation(theImage); NSString *postLength = [NSString stringWithFormat:@"%d",[imageData length]]; NSString *urlString = [@"http://www.amolconsultants.com/im.jsp?" stringByAppendingString:@"imagedata=iPhoneV0&mcid="]; urlString = [urlString stringByAppendingString:uniqueId]; urlString = [urlString stringByAppendingString:@"&lang=en_US.UTF-8"]; NSLog(@"The URL of the image is :- %@", urlString); NSMutableURLRequest *request = [[[NSMutableURLRequest alloc] init] autorelease]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; [request setValue:postLength forHTTPHeaderField:@"Content-Length"]; [request setHTTPBody:imageData]; NSURLConnection *conn=[[NSURLConnection alloc] initWithRequest:request delegate:self]; if (conn == nil) { NSLog(@"Failed to create the connection"); } } But nothing is getting posted. Nothing comes in the console window also. I am calling this method in the action sheet. When the user clicks on the 1st button of the action sheet this method is called to post the image. Can anyone help me with this... Any code will be very helpful... Thanx in advance...

    Read the article

  • Dynamic CSS class names in GWT

    - by Anupam Jain
    I am in the process of porting a simple CSS grid system to GWT. My CSS file currently has classes like .size1, .size2 etc., and I have a CSS resource that looks like - class MyResource extends CSSResource { @ClassName("size1") String size1(); @ClassName("size2") String size2(); // And so on } However what I really want, is to have a single function like the following - String size(int size); which will generate the appropriate class when passed the size as an integer at runtime. This is needed as I perform some calculations to determine the actual space available/needed for a widget in javascript and then attach the appropriate class name. Is this something that is even possible with GWT?

    Read the article

  • Replacing text node of HTML input in PHP

    - by Aman Kumar Jain
    Hi, I want to replace all the text nodes in a html text. I'll explain with an example: $html = " <div> <p> text2 text2 word text2 <span>abcd</span> text2 text2 word text2 <p> this is a long, very long statement with punctuations. </div> I want to replace "text2 text2 word text2" with "<span>text2 text2 word text2</span>" and "this is a long, very long statement with punctuations." with "<span>this is a long, very long statement with punctuations.</span>" What should be the regular expression for the same?

    Read the article

< Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >