Search Results

Search found 17039 results on 682 pages for 'empty row'.

Page 142/682 | < Previous Page | 138 139 140 141 142 143 144 145 146 147 148 149  | Next Page >

  • Nested IF's in Excel

    - by user1590499
    I have two columns with the following possibilities (0 for first column, and then 0 or 1 for second column; or a string for first column, and a 0 or 1 for second column). name,flag 0,0 david,0 0,1 sammy,1 How would I create a third column that looks like the following: name+flag 0 david 1 sammy Basically, if there are 2 0's in the two columns in a row, put a 0 in the new column. if there is a string in the first column in the row, no matter what the second column in the row says, put the string in the new column. and if there is a 0 in the first column and a 1 on the second column, put a 1 in the third column. Can I do this best with nested-if's? I tried something like name, flag, name+flag 0,0,=IF(A2<>0,A2,IF(B2=1,B2,0),0) But it didn't seem to work for me...

    Read the article

  • In Excel, given a worksheet "A", how do you create a sheet "B" that has a subset of the rows in "A"?

    - by user32706
    In Excel 2007, I have a sheet full of data "A". One of the columns in sheet "B" is called "Valid" and has either "yes" or "no". I've created a second sheet "B". It's easy to make each row in "A" appear in "B" if the row is valid using an 'if' statement in each cell. But if it's invalid, there's a blank row. I need "B" to show only the rows from "A" that are valid. TWO BIG CAVEATS: - No macros - No filtering (for long and complicated reasons). I feel like it might be possible with vlookup used cleverly, but so far, I'm stumped.

    Read the article

  • Will the Canon Pixma MX882 Wireless Multifunction Printer allow you to keep printing once one ink cartridge has run out?

    - by braveterry
    My wife's Epson Workforce 600 has died, and I'm thinking of replacing it with a Canon Pixma MX882 printer/scanner/copier/fax. One of the most annoying things about the Epson is that once it has decided that one of the ink cartridges is empty, it will not let you print anything until the empty cartridge is replaced. I have a Canon IP1800 that will let you print until a cartridge actually runs out of ink, and even when a cartridge is depleted, I can continue to print using the other colors. (The driver allows you to print using only the color cartridges or using only the black cartridge.) Questions: Will the Canon Pixma MX882 allow me to print until the ink runs out or will it declare the cartridge empty while ink is still left? Will the Canon Pixma MX882 allow me to keep printing even after one of the cartridges has been used up?

    Read the article

  • Puppet templates and undefined/nil variables

    - by larsks
    I often want to include default values in Puppet templates. I was hoping that given a class like this: class myclass ($a_variable=undef) { file { '/tmp/myfile': content => template('myclass/myfile.erb'), } } I could make a template like this: a_variable = <%= a_variable || "a default value" %> Unfortunately, undef in Puppet doesn't translate to a Ruby nil value in the context of the template, so this doesn't actually work. What is the canonical way of handling default values in Puppet templates? I can set the default value to an empty string and then use the empty? test... a variable = <%= a_variable.empty? ? "a default value" : a_variable %> ...but that seems a little clunky.

    Read the article

  • Install ubuntu with Win7

    - by 123Ex
    I'm using windows 7, Now I need to install Ubuntu 11.04 to the my lap top, I want keep win7 in my lap, I'm planing to keep dual boot system on my lap, I want to install Ubuntu on separate partition, I have deleted my windows empty partition to allocate the space to Ubuntu but when I'm proceeding with installation in Ubuntu, I couldn't recognize the empty partition, Ubuntu shows my full hard disk space one 50GB partition to install, I couldn't recognize the 50GB partition, can anyone tell me how to install Ubuntu on my lap. I really appreciate it, I want to install Ubuntu without loosing my existing data, to do that I have allocated empty unlocated disk space. Thank you in advance!

    Read the article

  • Can't insert cells in Excel 2010 - "operation not allowed" error message

    - by Force Flow
    I was working on a spreadsheet in Excel 2010, and all of a sudden when I attempted to insert a new row of cells, I saw that the insert and delete options were grayed out. I attempted to copy a different row and insert it as a new row, but I got the error message: "This operation is not allowed. The operation is attempting to shift cells in a table on your worksheet." I have not merged or hidden any cells/rows/columns. There are no formulas. There is no data verification. I tried closing and re-opening the spreadsheet. Searching for answers brings up nothing useful.

    Read the article

  • How to link data in different worksheets

    - by user2961726
    I tried consolidation but I can not get the following to work as it keeps saying no data consolidated. Can somebody try this dummy application and if they figure out how to do the following below can give me a step by step guide so I can attempt myself to learn. I'm not sure if I need to use any coding for this: In the dummy application I have 2 worksheets. One known as "1st", the other "Cases". In the "1st" worksheet you can insert and delete records for the "Case" table at the bottom, what I want to do is insert a row into the Case Table in worksheet "1st" and enter in the data for that row. What should happen is that data should be automatically be updated in the table in the "Cases" worksheet. But I can't seem to get this to work. Also if I delete a row from the table in Worksheet "1st" it should automatically remove that record from the "Cases" worksheet table. Please help. Below is the spreadsheet: http://ge.tt/8sjdkVx/v/0

    Read the article

  • Repeat the csv header twice without "Append" (PowerShell 1.0)

    - by Mark
    I have prepared a PowerShell script to export a list of system users in CSV format. The script can output the users list with Export-csv with single header row (the header row at top). However my requirement is to repeat the header row twice in my file. It is easy to achieve in PowerShell 3.0 with "Append" (e.g. $header | out-file $filepath -Append) Our server envirnoment is running PowerShell 1.0. Hence I cannot do it. Is there any workaround? I cannot manually add it myself. Thank you.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • C# Bind DataTable to Existing DataGridView Column Definitions

    - by Timothy
    I've been struggling with a NullReferenceException and hope someone here will be able to point me in the right direction. I'm trying to create and populate a DataTable and then show the results in a DataGridView control. The basic code follows, and Execution stops with a NullReferenceException at the point where I invoke the new UpdateResults_Delegate. Oddly enough, I can trace entries.Rows.Count successfully before I return it from QueryEventEntries, so I can at least show 1) entries is not a null reference, and 2) the DataTable contains rows of data. I know I have to be doing something wrong, but I just don't know what. private void UpdateResults(DataTable entries) { dataGridView.DataSource = entries; } private void button_Click(object sender, EventArgs e) { PerformQuery(); } private void PerformQuery() { DateTime start = new DateTime(dateTimePicker1.Value.Year, dateTimePicker1.Value.Month, dateTimePicker1.Value.Day, 0, 0, 0); DateTime stop = new DateTime(dateTimePicker2.Value.Year, dateTimePicker2.Value.Month, dateTimePicker2.Value.Day, 0, 0, 0); DataTable entries = QueryEventEntries(start, stop); UpdateResults(entries); } private DataTable QueryEventEntries(DateTime start, DateTime stop) { DataTable entries = new DataTable(); entries.Columns.AddRange(new DataColumn[] { new DataColumn("event_type", typeof(Int32)), new DataColumn("event_time", typeof(DateTime)), new DataColumn("event_detail", typeof(String))}); using (SqlConnection conn = new SqlConnection(DSN)) { using (SqlDataAdapter adapter = new SqlDataAdapter( "SELECT event_type, event_time, event_detail FROM event_log " + "WHERE event_time >= @start AND event_time <= @stop", conn)) { adapter.SelectCommand.Parameters.AddRange(new Object[] { new SqlParameter("@start", start), new SqlParameter("@stop", stop)}); adapter.Fill(entries); } } return entries; } Update I'd like to summarize and provide some additional information I've learned from the discussion here and debugging efforts since I originally posted this question. I am refactoring old code that retrieved records from a database, collected those records as an array, and then later iterated through the array to populate a DataGridView row by row. Threading was originally implemented to compensate and keep the UI responsive during the unnecessary looping. I have since stripped out Thread/Invoke; everything now occurs on the same execution thread (thank you, Sam). I am attempting to replace the slow, unwieldy approach using a DataTable which I can fill with a DataAdapter, and assign to the DataGridView through it's DataSource property (above code updated). I've iterated through the entries DataTable's rows to verify the table contains the expected data before assigning it as the DataGridView's DataSource. foreach (DataRow row in entries.Rows) { System.Diagnostics.Trace.WriteLine( String.Format("{0} {1} {2}", row[0], row[1], row[2])); } One of the column of the DataGridView is a custom DataGridViewColumn to stylize the event_type value. I apologize I didn't mention this before in the original post but I wasn't aware it was important to my problem. I have converted this column temporarily to a standard DataGridViewTextBoxColumn control and am no longer experiencing the Exception. The fields in the DataTable are appended to the list of fields that have been pre-specified in Design view of the DataGridView. The records' values are being populated in these appended fields. When the run time attempts to render the cell a null value is provided (as the value that should be rendered is done so a couple columns over). In light of this, I am re-titling and re-tagging the question. I would still appreciate it if others who have experienced this can instruct me on how to go about binding the DataTable to the existing column definitions of the DataGridView.

    Read the article

  • PHP/GD - Cropping and Resizing Images

    - by Alix Axel
    I've coded a function that crops an image to a given aspect ratio and finally then resizes it and outputs it as JPG: <?php function Image($image, $crop = null, $size = null) { $image = ImageCreateFromString(file_get_contents($image)); if (is_resource($image) === true) { $x = 0; $y = 0; $width = imagesx($image); $height = imagesy($image); /* CROP (Aspect Ratio) Section */ if (is_null($crop) === true) { $crop = array($width, $height); } else { $crop = array_filter(explode(':', $crop)); if (empty($crop) === true) { $crop = array($width, $height); } else { if ((empty($crop[0]) === true) || (is_numeric($crop[0]) === false)) { $crop[0] = $crop[1]; } else if ((empty($crop[1]) === true) || (is_numeric($crop[1]) === false)) { $crop[1] = $crop[0]; } } $ratio = array ( 0 => $width / $height, 1 => $crop[0] / $crop[1], ); if ($ratio[0] > $ratio[1]) { $width = $height * $ratio[1]; $x = (imagesx($image) - $width) / 2; } else if ($ratio[0] < $ratio[1]) { $height = $width / $ratio[1]; $y = (imagesy($image) - $height) / 2; } /* How can I skip (join) this operation with the one in the Resize Section? */ $result = ImageCreateTrueColor($width, $height); if (is_resource($result) === true) { ImageSaveAlpha($result, true); ImageAlphaBlending($result, false); ImageFill($result, 0, 0, ImageColorAllocateAlpha($result, 255, 255, 255, 127)); ImageCopyResampled($result, $image, 0, 0, $x, $y, $width, $height, $width, $height); $image = $result; } } /* Resize Section */ if (is_null($size) === true) { $size = array(imagesx($image), imagesy($image)); } else { $size = array_filter(explode('x', $size)); if (empty($size) === true) { $size = array(imagesx($image), imagesy($image)); } else { if ((empty($size[0]) === true) || (is_numeric($size[0]) === false)) { $size[0] = round($size[1] * imagesx($image) / imagesy($image)); } else if ((empty($size[1]) === true) || (is_numeric($size[1]) === false)) { $size[1] = round($size[0] * imagesy($image) / imagesx($image)); } } } $result = ImageCreateTrueColor($size[0], $size[1]); if (is_resource($result) === true) { ImageSaveAlpha($result, true); ImageAlphaBlending($result, true); ImageFill($result, 0, 0, ImageColorAllocate($result, 255, 255, 255)); ImageCopyResampled($result, $image, 0, 0, 0, 0, $size[0], $size[1], imagesx($image), imagesy($image)); header('Content-Type: image/jpeg'); ImageInterlace($result, true); ImageJPEG($result, null, 90); } } return false; } ?> The function works as expected but I'm creating a non-required GD image resource, how can I fix it? I've tried joining both calls but I must be doing some miscalculations. <?php /* Usage Examples */ Image('http://upload.wikimedia.org/wikipedia/commons/4/47/PNG_transparency_demonstration_1.png', '1:1', '600x'); Image('http://upload.wikimedia.org/wikipedia/commons/4/47/PNG_transparency_demonstration_1.png', '2:1', '600x'); Image('http://upload.wikimedia.org/wikipedia/commons/4/47/PNG_transparency_demonstration_1.png', '2:', '250x300'); ?> Any help is greatly appreciated, thanks.

    Read the article

  • Getting values from Dynamic elements.

    - by nCdy
    I'm adding some dynamic elements to my WebApp this way : (Language used is Nemerele (It has a simple C#-like syntax)) unless (GridView1.Rows.Count==0) { foreach(index with row = GridView1.Rows[index] in [0..GridView1.Rows.Count-1]) { row.Cells[0].Controls.Add ({ def TB = TextBox(); TB.EnableViewState = false; unless(row.Cells[0].Text == "&nbsp;") { TB.Text = row.Cells[0].Text; row.Cells[0].Text = ""; } TB.ID=TB.ClientID; TB.Width = 60; TB }); row.Cells[0].Controls.Add ({ def B = Button(); B.EnableViewState = false; B.Width = 80; B.Text = "?????????"; B.UseSubmitBehavior=false; // Makes no sense //B.OnClientClick="select(5);"; // HERE I CAN KNOW ABOUT TB.ID //B.Click+=EventHandler(fun(_,_) : void { }); // POST BACK KILL THAT ALL B }); } } This textboxes must make first field of GridView editable so ... but now I need to save a values. I can't do it on server side because any postback will Destroy all dynamic elements so I must do it without Post Back. So I try ... <script type="text/javascript" src="Scripts/jquery-1.4.1.min.js"></script> <script type="text/javascript"> function CallPageMethod(methodName, onSuccess, onFail) { var args = ''; var l = arguments.length; if (l > 3) { for (var i = 3; i < l - 1; i += 2) { if (args.length != 0) args += ','; args += '"' + arguments[i] + '":"' + arguments[i + 1] + '"'; } } var loc = window.location.href; loc = (loc.substr(loc.length - 1, 1) == "/") ? loc + "Report.aspx" : loc; $.ajax({ type: "POST", url: loc + "/" + methodName, data: "{" + args + "}", contentType: "application/json; charset=utf-8", dataType: "json", success: onSuccess, fail: onFail }); } function select(index) { var id = $("#id" + index).html(); CallPageMethod("SelectBook", success, fail, "id",id); } function success(response) { alert(response.d); } function fail(response) { alert("&#1054;&#1096;&#1080;&#1073;&#1082;&#1072;."); } </script> So... here is a trouble string : var id = $("#id" + index).html(); I know what is ID here : TB.ID=TB.ClientID; (when I add it) but I have no idea how to send it on Web Form. If I can add something like this div : <div id="Result" onclick="select(<%= " TB.ID " %>);"> Click here. </div> from the code it will be really goal, but I can't add this element as from CodeBehind as a dynamic element. So how can I transfer TB.ID or TB.ClientID to some static div Or how can I add some clickable dynamic element without PostBack to not destroy all my dynamic elements. Thank you.

    Read the article

  • handle null values for string when implementing IXmlSerializable interface

    - by user208081
    I have the following class that implements IXmlSerializable. When implementing WriteXml(), I need to handle the case where the string members of this class may be null values. What is the best way of handling this? Currently, I am using the default constructor in which all the string properties are initialized to empty string values. This way, when WriteXml() is called, the string will not be null. One other way I could do this is check using String.IsNullOrEmpty before writing each string in xml. Any suggestions on how I can improve this code? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Xml.Serialization; using System.Globalization; namespace TCS.Common.InformationObjects { public sealed class FaxSender : IXmlSerializable { #region Public Constants private const string DEFAULT_CLASS_NAME = "FaxSender"; #endregion Public Constants #region Public Properties public string Name { get; set; } public string Organization { get; set; } public string PhoneNumber { get; set; } public string FaxNumber { get; set; } public string EmailAddress { get; set; } #endregion Public Properties #region Public Methods #region Constructors public FaxSender() { Name = String.Empty; Organization = String.Empty; PhoneNumber = String.Empty; FaxNumber = String.Empty; EmailAddress = String.Empty; } public FaxSender(string name, string organization, string phoneNumber, string faxNumber, string emailAddress) { Name = name; Organization = organization; PhoneNumber = phoneNumber; FaxNumber = faxNumber; EmailAddress = emailAddress; } #endregion Constructors #region IXmlSerializable Members public System.Xml.Schema.XmlSchema GetSchema() { throw new NotImplementedException(); } public void ReadXml(System.Xml.XmlReader reader) { throw new NotImplementedException(); } public void WriteXml(System.Xml.XmlWriter xmlWriter) { try { // <sender> xmlWriter.WriteStartElement("sender"); // Write the name of the sender as an element. xmlWriter.WriteElementString("name", this.Name.ToString(CultureInfo.CurrentCulture)); // Write the organization of the sender as an element. xmlWriter.WriteElementString("organization", this.Organization.ToString(CultureInfo.CurrentCulture)); // Write the phone number of the sender as an element. xmlWriter.WriteElementString("phone_number", this.PhoneNumber.ToString(CultureInfo.CurrentCulture)); // Write the fax number of the sender as an element. xmlWriter.WriteElementString("fax_number", this.FaxNumber.ToString(CultureInfo.CurrentCulture)); // Write the email address of the sender as an element. xmlWriter.WriteElementString("email_address", this.EmailAddress.ToString(CultureInfo.CurrentCulture)); // </sender> xmlWriter.WriteEndElement(); } catch { // Rethrow any exceptions. throw; } } #endregion IXmlSerializable Members #endregion Public Methods } }

    Read the article

  • How to have two UIPickerViews together in one ViewController?

    - by 0SX
    I'm trying to put 2 UIPickerViews together in one ViewController. Each UIPickerView has different data arrays. I'm using interface builder to link the pickers up. I know I'll have to use separate delegates and dataSources but I can't seem to hook everything up with interface builder correctly. Here's all my code: pickerTesting.h #import <UIKit/UIKit.h> #import "picker2DataSource.h" @interface pickerTestingViewController : UIViewController <UIPickerViewDelegate, UIPickerViewDataSource>{ IBOutlet UIPickerView *picker; IBOutlet UIPickerView *picker2; NSMutableArray *pickerViewArray; } @property (nonatomic, retain) IBOutlet UIPickerView *picker; @property (nonatomic, retain) IBOutlet UIPickerView *picker2; @property (nonatomic, retain) NSMutableArray *pickerViewArray; @end pickerTesting.m #import "pickerTestingViewController.h" @implementation pickerTestingViewController @synthesize picker, picker2, pickerViewArray; - (void)viewDidLoad { [super viewDidLoad]; pickerViewArray = [[NSMutableArray alloc] init]; [pickerViewArray addObject:@" 100 "]; [pickerViewArray addObject:@" 200 "]; [pickerViewArray addObject:@" 400 "]; [pickerViewArray addObject:@" 600 "]; [pickerViewArray addObject:@" 1000 "]; [picker selectRow:1 inComponent:0 animated:NO]; picker2.delegate = self; picker2.dataSource = self; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker; { return 1; } - (void)pickerView:(UIPickerView *)picker didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker numberOfRowsInComponent:(NSInteger)component; { return [pickerViewArray count]; } - (NSString *)pickerView:(UIPickerView *)picker titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [pickerViewArray objectAtIndex:row]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end And I have a separate class for the other datasource. picker2DataSource.h @interface picker2DataSource : NSObject <UIPickerViewDataSource, UIPickerViewDelegate> { NSMutableArray *customPickerArray; } @property (nonatomic, retain) NSMutableArray *customPickerArray; @end picker2DataSource.m #import "picker2DataSource.h" @implementation picker2DataSource @synthesize customPickerArray; - (id)init { // use predetermined frame size self = [super init]; if (self) { customPickerArray = [[NSMutableArray alloc] init]; [customPickerArray addObject:@" a "]; [customPickerArray addObject:@" b "]; [customPickerArray addObject:@" c "]; [customPickerArray addObject:@" d "]; [customPickerArray addObject:@" e "]; } return self; } - (void)dealloc { [customPickerArray release]; [super dealloc]; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker2; { return 1; } - (void)pickerView:(UIPickerView *)picker2 didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker2 numberOfRowsInComponent:(NSInteger)component; { return [customPickerArray count]; } - (NSString *)pickerView:(UIPickerView *)picker2 titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [customPickerArray objectAtIndex:row]; } @end Any help or code examples would be great. Thanks.

    Read the article

  • How do I go about overloading C++ operators to allow for chaining?

    - by fneep
    I, like so many programmers before me, am tearing my hair out writing the right-of-passage-matrix-class-in-C++. I have never done very serious operator overloading and this is causing issues. Essentially, by stepping through This is what I call to cause the problems. cMatrix Kev = CT::cMatrix::GetUnitMatrix(4, true); Kev *= 4.0f; cMatrix Baz = Kev; Kev = Kev+Baz; //HERE! What seems to be happening according to the debugger is that Kev and Baz are added but then the value is lost and when it comes to reassigning to Kev, the memory is just its default dodgy values. How do I overload my operators to allow for this statement? My (stripped down) code is below. //header class cMatrix { private: float* _internal; UInt32 _r; UInt32 _c; bool _zeroindexed; //fast, assumes zero index, no safety checks float cMatrix::_getelement(UInt32 r, UInt32 c) { return _internal[(r*this->_c)+c]; } void cMatrix::_setelement(UInt32 r, UInt32 c, float Value) { _internal[(r*this->_c)+c] = Value; } public: cMatrix(UInt32 r, UInt32 c, bool IsZeroIndexed); cMatrix( cMatrix& m); ~cMatrix(void); //operators cMatrix& operator + (cMatrix m); cMatrix& operator += (cMatrix m); cMatrix& operator = (const cMatrix &m); }; //stripped source file cMatrix::cMatrix(cMatrix& m) { _r = m._r; _c = m._c; _zeroindexed = m._zeroindexed; _internal = new float[_r*_c]; UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] = m._internal[i]; } } cMatrix::~cMatrix(void) { delete[] _internal; } cMatrix& cMatrix::operator+(cMatrix m) { return cMatrix(*this) += m; } cMatrix& cMatrix::operator*(float f) { return cMatrix(*this) *= f; } cMatrix& cMatrix::operator*=(float f) { UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] *= f; } return *this; } cMatrix& cMatrix::operator+=(cMatrix m) { if (_c != m._c || _r != m._r) { throw new cCTException("Cannot add two matrix classes of different sizes."); } if (!(_zeroindexed && m._zeroindexed)) { throw new cCTException("Zero-Indexed mismatch."); } for (UInt32 row = 0; row < _r; row++) { for (UInt32 column = 0; column < _c; column++) { float Current = _getelement(row, column) + m._getelement(row, column); _setelement(row, column, Current); } } return *this; } cMatrix& cMatrix::operator=(const cMatrix &m) { if (this != &m) { _r = m._r; _c = m._c; _zeroindexed = m._zeroindexed; delete[] _internal; _internal = new float[_r*_c]; UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] = m._internal[i]; } } return *this; }

    Read the article

  • Changing the background color of a view in real-time.

    - by Tarmon
    Hey Everyone, I am trying to implement a ListView that is composed of rows that contain a View on the left followed by a TextView to the right of that. I want to be able to change the background color of the first View based on it's position in the ListView. Below is what I have at this point but it doesn't seem to due anything. public class Routes extends ListActivity { String[] ROUTES; TextView selection; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); ROUTES = getResources().getStringArray(R.array.routes); setContentView(R.layout.routes); setListAdapter(new IconicAdapter()); selection=(TextView)findViewById(R.id.selection); } public void onListItemClick(ListView parent, View v, int position, long id) { selection.setText(ROUTES[position]); } class IconicAdapter extends ArrayAdapter<String> { IconicAdapter() { super(Routes.this, R.layout.row, R.id.label, ROUTES); } } public View getView(int position, View convertView, ViewGroup parent) { LayoutInflater inflater = getLayoutInflater(); View row = inflater.inflate(R.layout.row, parent, false); TextView label = (TextView) row.findViewById(R.id.label); label.setText(ROUTES[position]); View icon = (View) row.findViewById(R.id.icon); switch(position){ case 0: icon.setBackgroundColor(R.color.Red); break; case 1: icon.setBackgroundColor(R.color.Red); break; case 2: icon.setBackgroundColor(R.color.Green); break; case 3: icon.setBackgroundColor(R.color.Green); break; case 4: icon.setBackgroundColor(R.color.Blue); break; case 5: icon.setBackgroundColor(R.color.Blue); break; case 6: icon.setBackgroundColor(R.color.Gray); break; case 7: icon.setBackgroundColor(R.color.Yellow); break; case 8: icon.setBackgroundColor(R.color.Brown); break; case 9: icon.setBackgroundColor(R.color.Brown); break; case 10: icon.setBackgroundColor(R.color.Brown); break; case 11: icon.setBackgroundColor(R.color.Purple); break; case 12: icon.setBackgroundColor(R.color.Red); break; case 13: icon.setBackgroundColor(R.color.Gold); break; case 14: icon.setBackgroundColor(R.color.Orange); break; } return(row); } } Any input is appreciated and if you have any questions don't hesitate to ask! Thanks, Rob

    Read the article

  • How do I call up values in PHP for user input in forms (radio buttons and selects)

    - by Derek
    Ok so my admin sets to edit a book which was created. I know how to bring in the values that were initially entered via a simple text field like 'bookname'. On the edit book page the book name field stores the currently assigned 'bookname' in the field (which is what I want! :) ) However I have other field types like selects and radio button entries...I'm having trouble calling in the already set value when the book was created. For example, there is a 'booklevel' field, which I have set as radio button entries as; Hard, Normal, and Easy. When the user goes to edit the book, I'm not too sure on how to have the current value drawn up (its stored as text) and the radio button being checked. I.e. 'Normal' is checked if this is what was set when the book was created. So far I have this as the code for the adding book level: <label>Book Level:</label> <label for="booklevel1" class="radio">Hard <input type="radio" name="booklevel" id="booklevel1" value="<?php echo 'Hard'; if (isset($_POST['booklevel'])); ?>"></label> <label for="booklevel2" class="radio">Medium<input type="radio" name="booklevel" id="booklevel2" value="<?php echo 'Normal'; if (isset($_POST['booklevel'])); ?>"></label> <label for="booklevel" class="radio">Low<input type="radio" name="booklevel" id="booklevel3" value="<?php echo 'Easy'; if (isset($_POST['booklevel'])); ?>"></label> This all works fine by the way when the user adds the book... But does anyone know how in my update book form, I can draw the value of what level has been set, and have the box checked?? To draw up the values in the text fields, I'm simply using: <?php echo $row['bookname']?> I also noticed a small issue when I call up the values for my Select options. I have the drop down select field display the currently set user (to read the book!), however, the drop down menu again displays the user in the list available options to select - basically meaning 2 of the same names appear in the list! Is there a way to eliminate the value of the SELECTED option? So far my setup for this is like: <select name="user_id" id="user_id"> <option value="<?php echo $row['user_id']?>" SELECTED><?php echo $row['fullname']?></option> <?php while($row = mysql_fetch_array($result)) { ?> <option value="<?php echo $row['user_id']?>"><?php echo $row['name']?></option> <?php } ?> </select> If anyone can help me I'll be very greatful. Sorry for the incredibly long question!! :)

    Read the article

  • DataTable to JSON

    - by Joel Coehoorn
    I recently needed to serialize a datatable to JSON. Where I'm at we're still on .Net 2.0, so I can't use the JSON serializer in .Net 3.5. I figured this must have been done before, so I went looking online and found a number of different options. Some of them depend on an additional library, which I would have a hard time pushing through here. Others require first converting to List<Dictionary<>>, which seemed a little awkward and needless. Another treated all values like a string. For one reason or another I couldn't really get behind any of them, so I decided to roll my own, which is posted below. As you can see from reading the //TODO comments, it's incomplete in a few places. This code is already in production here, so it does "work" in the basic sense. The places where it's incomplete are places where we know our production data won't currently hit it (no timespans or byte arrays in the db). The reason I'm posting here is that I feel like this can be a little better, and I'd like help finishing and improving this code. Any input welcome. public static class JSONHelper { public static string FromDataTable(DataTable dt) { string rowDelimiter = ""; StringBuilder result = new StringBuilder("["); foreach (DataRow row in dt.Rows) { result.Append(rowDelimiter); result.Append(FromDataRow(row)); rowDelimiter = ","; } result.Append("]"); return result.ToString(); } public static string FromDataRow(DataRow row) { DataColumnCollection cols = row.Table.Columns; string colDelimiter = ""; StringBuilder result = new StringBuilder("{"); for (int i = 0; i < cols.Count; i++) { // use index rather than foreach, so we can use the index for both the row and cols collection result.Append(colDelimiter).Append("\"") .Append(cols[i].ColumnName).Append("\":") .Append(JSONValueFromDataRowObject(row[i], cols[i].DataType)); colDelimiter = ","; } result.Append("}"); return result.ToString(); } // possible types: // http://msdn.microsoft.com/en-us/library/system.data.datacolumn.datatype(VS.80).aspx private static Type[] numeric = new Type[] {typeof(byte), typeof(decimal), typeof(double), typeof(Int16), typeof(Int32), typeof(SByte), typeof(Single), typeof(UInt16), typeof(UInt32), typeof(UInt64)}; // I don't want to rebuild this value for every date cell in the table private static long EpochTicks = new DateTime(1970, 1, 1).Ticks; private static string JSONValueFromDataRowObject(object value, Type DataType) { // null if (value == DBNull.Value) return "null"; // numeric if (Array.IndexOf(numeric, DataType) > -1) return value.ToString(); // TODO: eventually want to use a stricter format // boolean if (DataType == typeof(bool)) return ((bool)value) ? "true" : "false"; // date -- see http://weblogs.asp.net/bleroy/archive/2008/01/18/dates-and-json.aspx if (DataType == typeof(DateTime)) return "\"\\/Date(" + new TimeSpan(((DateTime)value).ToUniversalTime().Ticks - EpochTicks).TotalMilliseconds.ToString() + ")\\/\""; // TODO: add Timespan support // TODO: add Byte[] support //TODO: this would be _much_ faster with a state machine // string/char return "\"" + value.ToString().Replace(@"\", @"\\").Replace(Environment.NewLine, @"\n").Replace("\"", @"\""") + "\""; } }

    Read the article

  • I can't upload mp3 files using Codeigniter

    - by Drew
    There are lots of suggested fixes for this but none of them work for me. I have tried making the upload class (using the following methods: http://codeigniter.com/forums/viewthread/148605/ and http://codeigniter.com/forums/viewthread/125441/). When i try to upload an mp3 i get the error message "The filetype you are attempting to upload is not allowed". Below is my code for my model and my form (i've got a very skinny controller). If someone could help me out with this I would be eternally grateful. --Model-- function do_upload() { $soundfig['upload_path'] = './uploads/nav'; $soundfig['allowed_types'] = 'mp3'; $this->load->library('upload', $soundfig); if ( ! $this->upload->do_upload()) { $error = array('error' => $this->upload->display_errors()); return $error; } else { /* $data = $this->upload->data('userfile'); */ $sound = $this->upload->data(); /* $full_path = 'uploads/nav/' . $data['file_name']; */ $sound_path = 'uploads/nav/' . $sound['file_name']; if($this->input->post('active') == '1'){ $active = '1'; }else{ $active = '0'; } $spam = array( /* 'image_url' => $full_path, */ 'sound' => $sound_path, 'active' => $active, 'url' => $this->input->post('url') ); $id = $this->input->post('id'); $this->db->where('id', $id); $this->db->update('NavItemData', $spam); return true; } } --View - Form-- <?php echo form_open_multipart('upload/do_upload');?> <?php if(isset($buttons)) : foreach($buttons as $row) : ?> <h2><?php echo $row->name; ?></h2> <!-- <input type="file" name="userfile" size="20" /><br /> --> <input type="file" name="userfile" size="20" /> <input type="hidden" name="oldfile" value="<?php echo $row->image_url; ?>" /> <input type="hidden" name="id" value="<?php echo $row->id; ?>" /> <br /><br /> <label>Url: </label><input type="text" name="url" value="<?php echo $row->url; ?>" /><br /> <input type="checkbox" name="active" value="1" <?php if($row->active == '1') { echo 'checked'; } ?> /><br /><br /> <input type="submit" value="submit" /> </form> <?php endforeach; ?> <?php endif; ?>

    Read the article

  • Trying to get a better understanding of SelectedValuePath and IsSynchronizedWithCurrentItem

    - by rasx
    The following XAML produces a run-time Binding error when I click on an item in the ListBox: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:sys="clr-namespace:System;assembly=mscorlib" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" x:Class="WpfApplication1.MainWindow" x:Name="Window" Title="MainWindow" Width="640" Height="480"> <Window.Resources> <x:Array x:Key="strings" Type="{x:Type sys:String}"> <sys:String>one</sys:String> <sys:String>two</sys:String> <sys:String>three</sys:String> <sys:String>four</sys:String> </x:Array> </Window.Resources> <Grid> <ListBox DataContext="{StaticResource strings}" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding}" SelectedValuePath="{Binding /Length}"> <ListBox.ItemTemplate> <DataTemplate> <Grid> <Grid.Resources> <Style TargetType="{x:Type Label}"> <Setter Property="Background" Value="Yellow"/> <Setter Property="Margin" Value="0,0,4,0"/> <Setter Property="Padding" Value="0"/> </Style> </Grid.Resources> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition/> <RowDefinition/> </Grid.RowDefinitions> <!-- Row 0 --> <Label Grid.Column="0" Grid.Row="0">String:</Label> <TextBlock Grid.Column="1" Grid.Row="0" Text="{Binding}"/> <!-- Row 1 --> <Label Grid.Column="0" Grid.Row="1">Length:</Label> <TextBlock Grid.Column="1" Grid.Row="1" Text="{Binding Length, Mode=Default}"/> </Grid> </DataTemplate> </ListBox.ItemTemplate> </ListBox> </Grid> </Window> This is the run-time Binding error message: System.Windows.Data Error: 39 : BindingExpression path error: '3' property not found on 'object' ''String' (HashCode=1191344027)'. BindingExpression:Path=3; DataItem='String' (HashCode=1191344027); target element is 'ListBox' (Name=''); target property is 'NoTarget' (type 'Object') I would like the selected value of the ListBox to be the Length of the selected String object. What is wrong with my SelectedValuePath Binding syntax? Are there any related issues with IsSynchronizedWithCurrentItem?

    Read the article

  • Problems uploading different file types in codeigniter

    - by Drew
    Below is my script that i'm using to upload different files. All the solutions I've found deal only with multiple image uploads. I am totally stumped for a solution on this. Can someone tell me what it is i'm supposed to be doing to upload different files in the same form? Thanks function do_upload() { $config['upload_path'] = './uploads/nav'; $config['allowed_types'] = 'gif|jpg|png'; $config['max_size'] = '2000'; $this->load->library('upload', $config); if ( ! $this->upload->do_upload('userfile')) { $error = array('error' => $this->upload->display_errors()); return $error; } else { $soundfig['upload_path'] = './uploads/nav'; $soundfig['allowed_types'] = 'mp3|wav'; $this->load->library('upload', $soundfig); if ( ! $this->upload->do_upload('soundfile')) { $error = array('error' => $this->upload->display_errors()); return $error; } else { $data = $this->upload->data('userfile'); $sound = $this->upload->data('soundfile'); $full_path = 'uploads/nav/' . $data['file_name']; $sound_path = 'uploads/nav/' . $sound['file_name']; if($this->input->post('active') == '1'){ $active = '1'; }else{ $active = '0'; } $spam = array( 'image_url' => $full_path, 'sound' => $sound_path, 'active' => $active, 'url' => $this->input->post('url') ); $id = $this->input->post('id'); $this->db->where('id', $id); $this->db->update('NavItemData', $spam); return true; } } } Here is my form: <?php echo form_open_multipart('upload/do_upload');?> <?php if(isset($buttons)) : foreach($buttons as $row) : ?> <h2><?php echo $row->name; ?></h2> <input type="file" name="userfile" size="20" /><br /> <input type="file" name="soundfile" size="20" /> <input type="hidden" name="oldfile" value="<?php echo $row->image_url; ?>" /> <input type="hidden" name="id" value="<?php echo $row->id; ?>" /> <br /><br /> <label>Url: </label><input type="text" name="url" value="<?php echo $row->url; ?>" /><br /> <input type="checkbox" name="active" value="1" <?php if($row->active == '1') { echo 'checked'; } ?> /><br /><br /> <input type="submit" value="submit" /> </form> <?php endforeach; ?> <?php endif; ?>

    Read the article

  • MasterDetails Loading on Demand problem

    - by devnet247
    Hi As an exercise to learn wpf and understand how binding works I have an example that works.However when I try to load on demand I fail miserably. I basically have 3 classes Country-City-Hotels If I load ALL in one go it all works if I load on demand it fails miserably. What Am I doing wrong? Works <Window x:Class="MasterDetailCollectionViewSource.CountryCityHotelWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="CountryCityHotelWindow" Height="300" Width="450"> <Window.Resources> <CollectionViewSource Source="{Binding}" x:Key="cvsCountryList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCountryList},Path=Cities}" x:Key="cvsCityList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCityList},Path=Hotels}" x:Key="cvsHotelList"/> </Window.Resources> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition/> </Grid.RowDefinitions> <TextBlock Grid.Column="0" Grid.Row="0" Text="Countries"/> <TextBlock Grid.Column="1" Grid.Row="0" Text="Cities"/> <TextBlock Grid.Column="2" Grid.Row="0" Text="Hotels"/> <ListBox Grid.Column="0" Grid.Row="1" Name="lstCountries" ItemsSource="{Binding Source={StaticResource cvsCountryList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="1" Grid.Row="1" Name="lstCities" ItemsSource="{Binding Source={StaticResource cvsCityList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="2" Grid.Row="1" Name="lstHotels" ItemsSource="{Binding Source={StaticResource cvsHotelList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> </Grid> </Window> DOES NOT WORK Xaml is the same as above, however I have added the following that fetches stuff on demand. It loads the countries only as opposed to the other one where it Loads everything at once and not code behind is necessary. public CountryCityHotelWindow() { InitializeComponent(); //Load only country Initially lstCountries.ItemsSource=Repository.GetCountries(); DataContext = lstCountries; } private void OnSelectionChanged(object sender, SelectionChangedEventArgs e) { var lstBox = (ListBox)e.OriginalSource; switch (lstBox.Name) { case "lstCountries": var country = lstBox.SelectedItem as Country; if (country == null) return; lstCities.ItemsSource = Repository.GetCities(country.Name); break; case "lstCities": var city = lstBox.SelectedItem as City; if (city == null) return; lstHotels.ItemsSource = Repository.GetHotels(city.Name); break; case "lstHotels": break; } } What Am I doing Wrong? Thanks

    Read the article

  • Decentralized synchronized secure data storage

    - by Alberich
    Introduction Hi, I am going to ask a question which seems utopic for me, but I need to know if there is a way to achieve what I need. And if not, I need to know why not. The idea Suppose I have a database structure, in MySql. I want to create some solution to allow anyone (no matter who, no matter where) to have a synchronized copy (updated clone) of this database (with its content) Well, and it is not going to be just one synchronized copy, it could (and should) be a multiple replication (supposing the basic, this means, for example, ten copies all over the world) And, the most important thing: It must be secure. By secure I mean only real-accepted transactions will be synchronized with all the others (no matter how many) database copies/clones. Note: Since it would be quite difficult to make the synchronization in real-time, I will design everything to make this feature dispensable. So it is not required. My auto-suggestion This is how I am thinking to manage it: Time identifiers and Updates checking: Every action (insert, update, delete...) will be stored as the action instruction itself, associated to the time identifier. [I think better than a DATETIME field, it'll be an INT one, with the number of miliseconds passed from 1st january 2013 on, for example]. So each copy is going to ask to the "neighbour copy" for new actions done since last update, and execute them after checking they are allowed. Problem 1: the "neighbour copy" could be outdated too. Solution 1: do not ask just one neighbour, create a random list with some of the copies/clones and ask them for news (I could avoid the list and ask ALL the clones for updates, but this will be inefficient if clones number ascends too much). Problem 2: Real-time global synchronization is not active. What if... Someone at CLONE_ENTERPRISING inserts a row into TABLE. ... this row goes to every clone ... Someone at CLONE_FIXEMALL deletes this row. ... and at the same time, somewhere in an outdated clone ... Someone at CLONE_DROPOUT edits this row (now inexistent at the other clones) Solution 2: easy stuff, force a GLOBAL synchronization before doing any new "depending-on-third-data action" (edit, for example). This global synch. will be unnecessary when making an INSERT, for instance. Note: Well, someone could have some fun, and make the same insert in two clones... since they're not getting updated in real-time, this row will exist twice. But, it's the same as when we have one single database, in some needed cases we check if there is an existing same-row before doing the final action. Not a problem. Problem 3: It is possible to edit the code and do not filter actions, so someone could spread instructions to delete everything, or just make some trolling activity. This is not a problem, since good clones will always be somewhere. Those who got bad won't interest anymore. I really appreciate if you read. I know this is not the perfect solution, it has possibly hundred of holes, but it is my basic start. I will now appreciate anything you can teach me now. Thanks a lot. PS.: It could be that all this I am trying already exists and has its own name. Sorry for asking then (I'd anyway thank this name, if it exists)

    Read the article

  • How to select all options from a drop list in php / mysql

    - by Mirage81
    Thanks to stackoverflow.com's frienly experts I've managed to create my first php + mysql application. The code searches a mysql database for last names and cities. The choices are made through two drop lists like these: Choose city: All cities Liverpool Manchester Choose last name: All last names Lennon Gallagher The code would return eg. all the Lennons living in Liverpool. However, I haven't been able to make the options "All cities" and "All last names" to work so that the code would return eg. all the Lennons living in any city or all the people living in Liverpool. So, how can that be done? The code so far: index.php <?php $conn = mysql_connect('localhost', 'user', 'password') or die("Connection failed"); mysql_select_db("database", $conn) or die("Switch database failed"); //this gets the cities from the database to the drop list $query = "SELECT DISTINCT city FROM user".mysql_real_escape_string($city); $result = mysql_query($query, $conn); $options=""; while ($row=mysql_fetch_array($result)) { $city=$row["city"]; $options.="<OPTION VALUE=\"$city\">".$city; } //this gets the last names from the database to the drop list $query2 = "SELECT DISTINCT lastname FROM user".mysql_real_escape_string($lastname); $result2 = mysql_query($query2, $conn); $options2=""; while ($row2=mysql_fetch_array($result2)) { $lastname=$row2["lastname"]; $options2.="<OPTION VALUE=\"$lastname\">".$lastname; } ?> <!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN"> <html> <head> <meta content="text/html; charset=ISO-8859-1" http-equiv="content-type"> <title>test</title> </head> <body> <form action="get.php" method="post"> <p> <select name="city"> <option value=0>Choose <option value=1>All cities <?=$options?> </select> </p> <p> <select name="lastname"> <option value=0>Choose <option value=1>All last names <?=$options2?> </select> </p> <p> <input value="Search" type="submit"> </p> </form> <br> </body> </html> get.php <?php $conn = mysql_connect('localhost', 'user', 'password') or die("Connection failed"); mysql_select_db("database", $conn) or die("Switch database failed"); $query = "SELECT * FROM user WHERE city = '".mysql_real_escape_string($_POST['city'])."' AND lastname = '".mysql_real_escape_string($_POST['lastname'])."'"; $result = mysql_query($query, $conn); echo $rowcount; $zerorows=true; while ($row = mysql_fetch_assoc($result)) { $zerorows=false; echo '<b>City: </b>'.htmlspecialchars($row[city]).'<br />'; echo '<b>Last name: </b>'.htmlspecialchars($row[lastname]).'<br />'; echo '<b>Information: </b>'.htmlspecialchars($row[information]).'<br />'.'<br />'; } if($zerorows) echo "No results"; mysql_close($conn); ?>

    Read the article

< Previous Page | 138 139 140 141 142 143 144 145 146 147 148 149  | Next Page >