Search Results

Search found 6257 results on 251 pages for 'columns'.

Page 145/251 | < Previous Page | 141 142 143 144 145 146 147 148 149 150 151 152  | Next Page >

  • Slow Inserts SQL Server 2005

    - by Achilles
    I'm researching an issue with the following information: We had a logging table with about 90k records in it that had inserts taking several seconds(approximately 10 to 20s) in extreme cases. One of the columns of the table stores XML as the XML datatype. The XML isn't being parsed during the insert, just stored. We tried truncating the table assuming that the issue was related the number of records(althought 90k seemed "normal") and the inserts still are performing poorly. While I know there are other issues that can cloud the issue, what would be some "check this first" ideas that could help me debug this issue? Thanks for any suggestions and help in advance.

    Read the article

  • Convert SQL Query results to Active Directory Groups

    - by antgiant
    Are there any quality products (ideally open source) that allow me to run an arbitrary SQL query that results in 2 columns (username, group name) and they adds that username in AD to a group of that name in AD? If the username doesn't exist it is ignored. If the group name doesn't exist ideally it gets created. Updated for Clarity: I have a MSSQL based system that is the authoritative source for some of the Active Directory Security groups, and their members. I want to be able to to have those Active Directory Security Groups populated by a one-way sync originating from MSSQL. Sadly the MSSQL based system does not have a good API, so I will have to do this with direct SQL calls. Is there anything that does this well?

    Read the article

  • Finding throuput of CPU and Hardrive on Solaris

    - by Jim
    How do I find the throughput of a CPU and the hard disk on an OpenSolaris machine? Using mpstat or iostat? I'm having a hard time identifying the throughput if it is given at all in the commands output. For example, in mpstat there is very little explanation as to what the columns mean. I've been using the syscl column divided by time interval to find the throughput but to be honest I have no idea what a system call truly is. I'm trying to to analyze a hardrive and CPU while writing a file to the hardisk and when at rest.

    Read the article

  • Excel - Disable AutoFormatting on Import

    - by Philip Wales
    How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

    Read the article

  • What's the deal with NTFS tags in windows 7

    - by polarix
    So back in the days of 'longhorn' there was this WinFS idea which was both cool looking and scary looking. Then it seemed to disappear, but we were told that many of the concepts would be rolled into Vista. Then maybe Win7. Anyway, nowadays if you look at a win7 Explorer window, you can have columns that have a lot of tag-based info about a file (right click on column header-more...), including one called "tags". Is this something in NTFS that can be modified per-file somehow? Is its GUI hiding, or is this something that's infinitely-delayed, or is it just a figment of my imagination? Sure would be nice to be able to get around the NTFS path 256 character limit for searches, and to filter file folders per Excel 2007.

    Read the article

  • Very Strange behavior in custom dataGrid

    - by Markus
    Hi everybody, I asked this question already in a former post, but nobody could answer this question correctly. So I try to post the problem again, to make sure it's not a bug. I have a dataGrid with a custom itemRenderer. Everytime I tab at least two times on the dataGrid, the cell below the one I taped gets selected. This doesn't happen if I uncomment the code in the method saveBackDataGridContent()! The second problem is that if the Line is shorter than the entered text, a horizontalScrollBar will get active, although I set setStyle("horizontalScrollPolicy", "off");... Who can solve that one? CustomRenderer.mxml: <mx:Application xmlns:mx="http://www.adobe.com/2006/mxml" initialize="dataService.send()"> <mx:Script> <![CDATA[ import components.ChoiceRenderer; import mx.rpc.events.ResultEvent; import mx.events.DataGridEvent; private function resultHandler(event:ResultEvent):void { var doc:XML = event.result as XML; testGrid.dataProvider = doc.Records.BackSide; } private function saveBackDataGridContent(event:DataGridEvent):void{ testGrid.dataProvider[event.rowIndex].TextElement = event.currentTarget.itemEditorInstance.text; } ]]> </mx:Script> <mx:HTTPService id="dataService" result="resultHandler(event)" url = "data/example.xml" resultFormat="e4x"/> <mx:DataGrid id="testGrid" editable="true" itemEditEnd="saveBackDataGridContent(event)"> <mx:columns> <mx:DataGridColumn itemRenderer="components.ChoiceRenderer" width="230"/> </mx:columns> </mx:DataGrid> </mx:Application> ChoiceRenderer.as package components { import mx.containers.HBox; import mx.controls.CheckBox; import mx.controls.Label; public class ChoiceRenderer extends HBox { private var correctAnswer:CheckBox; private var choiceLabel:Label; public function ChoiceRenderer() { super(); setStyle("horizontalScrollPolicy", "off"); correctAnswer = new CheckBox; addChild(correctAnswer); choiceLabel = new Label; addChild(choiceLabel); } override public function set data(xmldata:Object):void{ if(xmldata.name() == "BackSide"){ super.data = xmldata.TextElement[0]; choiceLabel.text = xmldata.TextElement[0].toString(); } } } } example.xml <TopContainer> <Records> <BackSide> <TextElement>first</TextElement> </BackSide> <BackSide> <TextElement>second</TextElement> </BackSide> <BackSide> <TextElement>third</TextElement> </BackSide> <BackSide> <TextElement>fourth</TextElement> </BackSide> <BackSide> <TextElement>fifth</TextElement> </BackSide> <BackSide> <TextElement>sixth</TextElement> </BackSide> </Records> Thanks Markus

    Read the article

  • Using pivot tables to group transactions

    - by andreas
    I have my bank account statement and what I would like to do is group the descriptions of the transactions together with their debit or credit and sum their total. I could then see that, e.g., for ebay.com my total debit was $2000, etc. Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 What I want to do is use a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I am no able to do that, as I can't group the description and have additional debit and credit columns -- I get them all in rows with blanks.

    Read the article

  • How do I get around this lambda expression outer variable issue?

    - by panamack
    I'm playing with PropertyDescriptor and ICustomTypeDescriptor (still) trying to bind a WPF DataGrid to an object, for which the data is stored in a Dictionary. Since if you pass WPF DataGrid a list of Dictionary objects it will auto generate columns based on the public properties of a dictionary (Comparer, Count, Keys and Values) my Person subclasses Dictionary and implements ICustomTypeDescriptor. ICustomTypeDescriptor defines a GetProperties method which returns a PropertyDescriptorCollection. PropertyDescriptor is abstract so you have to subclass it, I figured I'd have a constructor that took Func and an Action parameters that delegate the getting and setting of the values in the dictionary. I then create a PersonPropertyDescriptor for each Key in the dictionary like this: foreach (string s in this.Keys) { var descriptor = new PersonPropertyDescriptor( s, new Func<object>(() => { return this[s]; }), new Action<object>(o => { this[s] = o; })); propList.Add(descriptor); } The problem is that each property get's its own Func and Action but they all share the outer variable s so although the DataGrid autogenerates columns for "ID","FirstName","LastName", "Age", "Gender" they all get and set against "Gender" which is the final resting value of s in the foreach loop. How can I ensure that each delegate uses the desired dictionary Key, i.e. the value of s at the time the Func/Action is instantiated? Much obliged. Here's the rest of my idea, I'm just experimenting here these are not 'real' classes... // DataGrid binds to a People instance public class People : List<Person> { public People() { this.Add(new Person()); } } public class Person : Dictionary<string, object>, ICustomTypeDescriptor { private static PropertyDescriptorCollection descriptors; public Person() { this["ID"] = "201203"; this["FirstName"] = "Bud"; this["LastName"] = "Tree"; this["Age"] = 99; this["Gender"] = "M"; } //... other ICustomTypeDescriptor members... public PropertyDescriptorCollection GetProperties() { if (descriptors == null) { var propList = new List<PropertyDescriptor>(); foreach (string s in this.Keys) { var descriptor = new PersonPropertyDescriptor( s, new Func<object>(() => { return this[s]; }), new Action<object>(o => { this[s] = o; })); propList.Add(descriptor); } descriptors = new PropertyDescriptorCollection(propList.ToArray()); } return descriptors; } //... other other ICustomTypeDescriptor members... } public class PersonPropertyDescriptor : PropertyDescriptor { private Func<object> getFunc; private Action<object> setAction; public PersonPropertyDescriptor(string name, Func<object> getFunc, Action<object> setAction) : base(name, null) { this.getFunc = getFunc; this.setAction = setAction; } // other ... PropertyDescriptor members... public override object GetValue(object component) { return getFunc(); } public override void SetValue(object component, object value) { setAction(value); } }

    Read the article

  • Are there any Spreadsheet apps that are as easy and powerful to use as Vim?

    - by ovatsug25
    I'd like to use a spreadsheet that lets me move around cells like I do in Vim. As well, the more commands that are attributed to keyboard shortcuts, the better. Particularly stuff like making Text-to-Columns which is one of my more frequently used features in Excel. I don't mind learning the shortcuts if they allow me to just look at the spreadsheet page and forget about everything else. edit: The way I am thinking about the Spreadsheet right now is as if every cell is its own unique file. There should be a command where I choose to open that file and edit it right on the spot within the view of the spreadsheet. So I guess I want different modes like in vim which have commands and there should be one mode that is hooked up just to do operations or formatting which would be similar to command mode in Vim.

    Read the article

  • I'm looking for a reliable way to verify T-SQL stored procedures. Anybody got one?

    - by Cory Larson
    Hi all-- We're upgrading from SQL Server 2005 to 2008. Almost every database in the 2005 instance is set to 2000 compatibility mode, but we're jumping to 2008. Our testing is complete, but what we've learned is that we need to get faster at it. I've discovered some stored procedures that either SELECT data from missing tables or try to ORDER BY columns that don't exist. Wrapping the SQL to create the procedures in SET PARSEONLY ON and trapping errors in a try/catch only catches the invalid columns in the ORDER BYs. It does not find the error with the procedure selecting data from the missing table. SSMS 2008's intellisense, however, DOES find the issue, but I can still go ahead and successfully run the ALTER script for the procedure without it complaining. So, why can I even get away with creating a procedure that fails when it runs? Are there any tools out there that can do better than what I've tried? The first tool I found wasn't very useful: DbValidator from CodeProject, but it finds fewer problems than this script I found on SqlServerCentral, which found the invalid column references. ------------------------------------------------------------------------- -- Check Syntax of Database Objects -- Copyrighted work. Free to use as a tool to check your own code or in -- any software not sold. All other uses require written permission. ------------------------------------------------------------------------- -- Turn on ParseOnly so that we don't actually execute anything. SET PARSEONLY ON GO -- Create a table to iterate through declare @ObjectList table (ID_NUM int NOT NULL IDENTITY (1, 1), OBJ_NAME varchar(255), OBJ_TYPE char(2)) -- Get a list of most of the scriptable objects in the DB. insert into @ObjectList (OBJ_NAME, OBJ_TYPE) SELECT name, type FROM sysobjects WHERE type in ('P', 'FN', 'IF', 'TF', 'TR', 'V') order by type, name -- Var to hold the SQL that we will be syntax checking declare @SQLToCheckSyntaxFor varchar(max) -- Var to hold the name of the object we are currently checking declare @ObjectName varchar(255) -- Var to hold the type of the object we are currently checking declare @ObjectType char(2) -- Var to indicate our current location in iterating through the list of objects declare @IDNum int -- Var to indicate the max number of objects we need to iterate through declare @MaxIDNum int -- Set the inital value and max value select @IDNum = Min(ID_NUM), @MaxIDNum = Max(ID_NUM) from @ObjectList -- Begin iteration while @IDNum <= @MaxIDNum begin -- Load per iteration values here select @ObjectName = OBJ_NAME, @ObjectType = OBJ_TYPE from @ObjectList where ID_NUM = @IDNum -- Get the text of the db Object (ie create script for the sproc) SELECT @SQLToCheckSyntaxFor = OBJECT_DEFINITION(OBJECT_ID(@ObjectName, @ObjectType)) begin try -- Run the create script (remember that PARSEONLY has been turned on) EXECUTE(@SQLToCheckSyntaxFor) end try begin catch -- See if the object name is the same in the script and the catalog (kind of a special error) if (ERROR_PROCEDURE() <> @ObjectName) begin print 'Error in ' + @ObjectName print ' The Name in the script is ' + ERROR_PROCEDURE()+ '. (They don''t match)' end -- If the error is just that this already exists then we don't want to report that. else if (ERROR_MESSAGE() <> 'There is already an object named ''' + ERROR_PROCEDURE() + ''' in the database.') begin -- Report the error that we got. print 'Error in ' + ERROR_PROCEDURE() print ' ERROR TEXT: ' + ERROR_MESSAGE() end end catch -- Setup to iterate to the next item in the table select @IDNum = case when Min(ID_NUM) is NULL then @IDNum + 1 else Min(ID_NUM) end from @ObjectList where ID_NUM > @IDNum end -- Turn the ParseOnly back off. SET PARSEONLY OFF GO Any suggestions?

    Read the article

  • Output a php multi-dimensional array to a html table

    - by Fireflight
    I have been banging my head against the wall with this one for nearly a week now, and am no closer than I was the first day. I have a form that has 8 columns and a variable number of rows which I need to email to the client in a nicely formatted email. The form submits the needed fields as a multidimensional array. Rough example is below: <input name="order[0][topdiameter]" type="text" id="topdiameter0" value="1" size="5" /> <input name="order[0][bottomdiameter]" type="text" id="bottomdiameter0" value="1" size="5" /> <input name="order[0][slantheight]" type="text" id="slantheight0" value="1" size="5" /> <select name="order[0][fittertype]" id="fittertype0"> <option value="harp">Harp</option> <option value="euro">Euro</option> <option value="bulbclip">Regular</option> </select> <input name="order[0][washerdrop]" type="text" id="washerdrop0" value="1" size="5" /> <select name="order[0][fabrictype]" id="fabrictype"> <option value="linen">Linen</option> <option value="pleated">Pleated</option> </select> <select name="order[0][colours]" id="colours0"> <option value="beige">Beige</option> <option value="white">White</option> <option value="eggshell">Eggshell</option> <option value="parchment">Parchment</option> </select> <input name="order[0][quantity]" type="text" id="quantity0" value="1" size="5" /> This form is formatted in a table, and rows can be added to it dynamically. What I've been unable to do is get a properly formatted table out of the array. This is what I'm using now (grabbed from the net). <?php if (isset($_POST["submit"])) { $arr= $_POST['order'] echo '<table>'; foreach($arr as $arrs) { echo '<tr>'; foreach($arrs as $item) { echo "<td>$item</td>"; } echo '</tr>'; } echo '</table>; }; ?> This works perfectly for a single row of data. If I try submitting 2 or more rows from the form then one of the columns disappears. I'd like the table to be formatted as: | top | Bottom | Slant | Fitter | Washer | Fabric | Colours | Quantity | ------------------------------------------------------------------------ |value| value | value | value | value | value | value | value | with additional rows as needed. But, I can't find any examples that will generate that type of table! It seems like this should be something fairly straightforward, but I just can't locate an example that works the way I need it too.

    Read the article

  • How change the layout (e.g. background-color) of autoplaylists in foobar2000?

    - by UdeF
    A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

    Read the article

  • Source File not updating Destination Files in Excel

    - by user127105
    I have one source file that holds all my input costs. I then have 30 to 40 destination files (costing sheets) that use links to data in this source file for their various formulae. I was sure when I started this system that any changes I made to the source file, including the insertion of new rows and columns was updated automatically by the destination files, such that the formula always pulled the correct input costs. Now all of a sudden if my destination files are closed and I change the structure of the source file by adding rows - the destination files go haywire? They pick up changes to their linked cells, but don't pick up changes to the source sheet that have shifted their relative positions in the sheet. Do I really need to open all 40 destination files at the same time I alter the source file structure? Further info: all the destination files are protected, and I am working on DropBox.

    Read the article

  • Do I need to manually create indexes for a DBIx::Class belongs_to relationship

    - by Dancrumb
    I'm using the DBIx::Class modules for an ORM approach to an application I have. I'm having some problems with my relationships. I have the following package MySchema::Result::ClusterIP; use strict; use warnings; use base qw/DBIx::Class::Core/; our $VERSION = '1.0'; __PACKAGE__->load_components(qw/InflateColumn::Object::Enum Core/); __PACKAGE__->table('cluster_ip'); __PACKAGE__->add_columns( # Columns here ); __PACKAGE__->set_primary_key('objkey'); __PACKAGE__->belongs_to( 'configuration' => 'MySchema::Result::Configuration', 'config_key'); __PACKAGE__->belongs_to( 'cluster' => 'MySchema::Result::Cluster', { 'foreign.config_key' => 'self.config_key', 'foreign.id' => 'self.cluster_id' } ); As well as package MySchema::Result::Cluster; use strict; use warnings; use base qw/DBIx::Class::Core/; our $VERSION = '1.0'; __PACKAGE__->load_components(qw/InflateColumn::Object::Enum Core/); __PACKAGE__->table('cluster'); __PACKAGE__->add_columns( # Columns here ); __PACKAGE__->set_primary_key('objkey'); __PACKAGE__->belongs_to( 'configuration' => 'MySchema::Result::Configuration', 'config_key'); __PACKAGE__->has_many('cluster_ip' => 'MySchema::Result::ClusterIP', { 'foreign.config_key' => 'self.config_key', 'foreign.cluster_id' => 'self.id' }); There are a couple of other modules, but I don't believe that they are relevant. When I attempt to deploy this schema, I get the following error: DBIx::Class::Schema::deploy(): DBI Exception: DBD::mysql::db do failed: Can't create table 'test.cluster_ip' (errno: 150) [ for Statement "CREATE TABLE `cluster_ip` ( `objkey` smallint(5) unsigned NOT NULL auto_increment, `config_key` smallint(5) unsigned NOT NULL, `cluster_id` char(16) NOT NULL, INDEX `cluster_ip_idx_config_key_cluster_id` (`config_key`, `cluster_id`), INDEX `cluster_ip_idx_config_key` (`config_key`), PRIMARY KEY (`objkey`), CONSTRAINT `cluster_ip_fk_config_key_cluster_id` FOREIGN KEY (`config_key`, `cluster_id`) REFERENCES `cluster` (`config_key`, `id`) ON DELETE CASCADE ON UPDATE CASCADE, CONSTRAINT `cluster_ip_fk_config_key` FOREIGN KEY (`config_key`) REFERENCES `configuration` (`config_key`) ON DELETE CASCADE ON UPDATE CASCADE ) ENGINE=InnoDB"] at test_deploy.pl line 18 (running "CREATE TABLE `cluster_ip` ( `objkey` smallint(5) unsigned NOT NULL auto_increment, `config_key` smallint(5) unsigned NOT NULL, `cluster_id` char(16) NOT NULL, INDEX `cluster_ip_idx_config_key_cluster_id` (`config_key`, `cluster_id`), INDEX `cluster_ip_idx_config_key` (`config_key`), PRIMARY KEY (`objkey`), CONSTRAINT `cluster_ip_fk_config_key_cluster_id` FOREIGN KEY (`config_key`, `cluster_id`) REFERENC ES `cluster` (`config_key`, `id`) ON DELETE CASCADE ON UPDATE CASCADE, CONSTRAINT `cluster_ip_fk_config_key` FOREIGN KEY (`config_key`) REFERENCES `configuration` (`conf ig_key`) ON DELETE CASCADE ON UPDATE CASCADE ) ENGINE=InnoDB") at test_deploy.pl line 18 From what I can tell, MySQL is complaining about the FOREIGN KEY constraint, in particular, the REFERENCE to (config_key, id) in the cluster table. From my reading of the MySQL documentation, this seems like a reasonable complaint, especially in regards to the third bullet point on this doc page. Here's my question. Am I missing something in the DBIx::Class module? I realize that I could explicitly create the necessary index to match up with this foreign key constraint, but that seems to be repetitive work. Is there something I should be doing to make this occur implicitly?

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • StoreGeneratedPattern T4 EntityFramework concern

    - by LoganWolfer
    Hi everyone, Here's the situation : I use SQL Server 2008 R2, SQL Replication, Visual Studio 2010, EntityFramework 4, C# 4. The course-of-action from our DBA is to use a rowguid column for SQL Replication to work with our setup. These columns need to have a StoreGeneratedPattern property set to Computed on every one of these columns. The problem : Every time the T4 template regenerate our EDMX (ADO.NET Entity Data Model) file (for example, when we update it from our database), I need to go manually in the EDMX XML file to add this property to every one of them. It has to go from this : <Property Name="rowguid" Type="uniqueidentifier" Nullable="false" /> To this : <Property Name="rowguid" Type="uniqueidentifier" Nullable="false" StoreGeneratedPattern="Computed"/> The solution : I'm trying to find a way to customize an ADO.NET EntityObject Generator T4 file to generate a StoreGeneratedPattern="Computed" to every rowguid that I have. I'm fairly new to T4, I only did customization to AddView and AddController T4 templates for ASP.NET MVC 2, like List.tt for example. I've looked through the EF T4 file, and I can't seem to find through this monster where I could do that (and how). My best guess is somewhere in this part of the file, line 544 to 618 of the original ADO.NET EntityObject Generator T4 file : //////// //////// Write PrimitiveType Properties. //////// private void WritePrimitiveTypeProperty(EdmProperty primitiveProperty, CodeGenerationTools code) { MetadataTools ef = new MetadataTools(this); #> /// <summary> /// <#=SummaryComment(primitiveProperty)#> /// </summary><#=LongDescriptionCommentElement(primitiveProperty, 1)#> [EdmScalarPropertyAttribute(EntityKeyProperty=<#=code.CreateLiteral(ef.IsKey(primitiveProperty))#>, IsNullable=<#=code.CreateLiteral(ef.IsNullable(primitiveProperty))#>)] [DataMemberAttribute()] <#=code.SpaceAfter(NewModifier(primitiveProperty))#><#=Accessibility.ForProperty(primitiveProperty)#> <#=code.Escape(primitiveProperty.TypeUsage)#> <#=code.Escape(primitiveProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(primitiveProperty))#>get { <#+ if (ef.ClrType(primitiveProperty.TypeUsage) == typeof(byte[])) { #> return StructuralObject.GetValidValue(<#=code.FieldName(primitiveProperty)#>); <#+ } else { #> return <#=code.FieldName(primitiveProperty)#>; <#+ } #> } <#=code.SpaceAfter(Accessibility.ForSetter((primitiveProperty)))#>set { <#+ if (ef.IsKey(primitiveProperty)) { if (ef.ClrType(primitiveProperty.TypeUsage) == typeof(byte[])) { #> if (!StructuralObject.BinaryEquals(<#=code.FieldName(primitiveProperty)#>, value)) <#+ } else { #> if (<#=code.FieldName(primitiveProperty)#> != value) <#+ } #> { <#+ PushIndent(CodeRegion.GetIndent(1)); } #> <#=ChangingMethodName(primitiveProperty)#>(value); ReportPropertyChanging("<#=primitiveProperty.Name#>"); <#=code.FieldName(primitiveProperty)#> = StructuralObject.SetValidValue(value<#=OptionalNullableParameterForSetValidValue(primitiveProperty, code)#>); ReportPropertyChanged("<#=primitiveProperty.Name#>"); <#=ChangedMethodName(primitiveProperty)#>(); <#+ if (ef.IsKey(primitiveProperty)) { PopIndent(); #> } <#+ } #> } } private <#=code.Escape(primitiveProperty.TypeUsage)#> <#=code.FieldName(primitiveProperty)#><#=code.StringBefore(" = ", code.CreateLiteral(primitiveProperty.DefaultValue))#>; partial void <#=ChangingMethodName(primitiveProperty)#>(<#=code.Escape(primitiveProperty.TypeUsage)#> value); partial void <#=ChangedMethodName(primitiveProperty)#>(); <#+ } Any help would be appreciated. Thanks in advance. EDIT : Didn't find answer to this problem yet, if anyone have ideas to automate this, would really be appreciated.

    Read the article

  • Many to many self join through junction table

    - by Peter
    I have an EF model that can self-reference through an intermediary class to define a parent/child relationship. I know how to do a pure many-to-many relationship using the Map command, but for some reason going through this intermediary class is causing problems with my mappings. The intermediary class provides additional properties for the relationship. See the classes, modelBinder logic and error below: public class Equipment { [Key] public int EquipmentId { get; set; } public virtual List<ChildRecord> Parents { get; set; } public virtual List<ChildRecord> Children { get; set; } } public class ChildRecord { [Key] public int ChildId { get; set; } [Required] public int Quantity { get; set; } [Required] public Equipment Parent { get; set; } [Required] public Equipment Child { get; set; } } I've tried building the mappings in both directions, though I only keep one set in at a time: modelBuilder.Entity<ChildRecord>() .HasRequired(x => x.Parent) .WithMany(x => x.Children ) .WillCascadeOnDelete(false); modelBuilder.Entity<ChildRecord>() .HasRequired(x => x.Child) .WithMany(x => x.Parents) .WillCascadeOnDelete(false); OR modelBuilder.Entity<Equipment>() .HasMany(x => x.Parents) .WithRequired(x => x.Child) .WillCascadeOnDelete(false); modelBuilder.Entity<Equipment>() .HasMany(x => x.Children) .WithRequired(x => x.Parent) .WillCascadeOnDelete(false); Regardless of which set I use, I get the error: The foreign key component 'Child' is not a declared property on type 'ChildRecord'. Verify that it has not been explicitly excluded from the model and that it is a valid primitive property. when I try do deploy my ef model to the database. If I build it without the modelBinder logic in place then I get two ID columns for Child and two ID columns for Parent in my ChildRecord table. This makes sense since it tries to auto create the navigation properties from Equipment and doesn't know that there are already properties in ChildRecord to fulfill this need. I tried using Data Annotations on the class, and no modelBuilder code, this failed with the same error as above: [Required] [ForeignKey("EquipmentId")] public Equipment Parent { get; set; } [Required] [ForeignKey("EquipmentId")] public Equipment Child { get; set; } AND [InverseProperty("Child")] public virtual List<ChildRecord> Parents { get; set; } [InverseProperty("Parent")] public virtual List<ChildRecord> Children { get; set; } I've looked at various other answers around the internet/SO, and the common difference seems to be that I am self joining where as all the answers I can find are for two different types. Entity Framework Code First Many to Many Setup For Existing Tables Many to many relationship with junction table in Entity Framework? Creating many to many junction table in Entity Framework

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • How can I create matrices of data in Excel?

    - by sandeep
    I want to create a 4*4 matrix in excel 2007 by taking three or more columns or conditions for example Column index Row index Name 1 2 x 2 3 y 3 4 z 4 1 p this is how data looks and i want it for 1*1 cell as p and 1*2 cell as x and so on. and I want out put as follows matrix 1 2 3 4 1 p x y z 2 p x y z 3 p x y z 4 p x y z and I have very huge data like this some times the matrix size goes up to 60*60 also.

    Read the article

  • Pivot tables in excel

    - by andreas
    Hey GUYS i have my account bank account statement and what i wanna do is group the description oof transactions together with their debit or credit and sum their total . So that i can see that for ebay.com my total debit was 2000 $ etc... no the data are like this (btw how do you format this?) Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 ETC.... what i wanna do is using a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I can seem to be able to do that as i cant group the description and have additional debit and credit columns.....as i get them all in rows with blanks

    Read the article

  • Regular expression in mySQL [migrated]

    - by Rayne
    I have a mysql table that has 2 columns - Column 1 contains a string value, and Column 2 contains the number of times that string value occurred. I'm trying to find the string abc.X.def, where the beginning of the string is "abc.", followed by one or more characters, then the string ".def". There could be more characters following ".def". How can I find such strings, then add the occurrence of such strings and display the results? For example, if I have abc.111.def23 1 abc.111.def 2 abc.22.def444 1 abc.111.def 1 Then I will get abc.111.def23 1 abc.111.def 3 abc.22.def444 1 Thank you.

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • How to lookup a value in a table with multiple criteria

    - by php-b-grader
    I have a data sheet with multiple values in multiple columns. I have a qty and a current price which when multiplied out gives me the current revenue (CurRev). I want to use this lookup table to give me the new revenue (NewRev) from the new price but can't figure out how to do multiple ifs in a lookup. What I want is to build a new column that checks the "Product", "Tier" and "Location/State" and gives me the new price from the lookup table (above) and then multiply that by the qty. e.g. Data > Product, Tier, Location, Qty, CurRev, NewRev > Product1, Tier1, VIC, 2, $1000.00, $6000 (2 x $3000) > Product2, Tier3, NSW, 1, $100.00, $200 (1 x $200) > Product1, Tier3, SA, 5, $250.00, $750 (5 x $150) > Product3, Tier1, ACT, 5, $100.00, $500(5 x $100) > Product2, Tier3, QLD, 2, $150.00, $240 (2 x $240) Worst case, if I just get the new rate I can create another column

    Read the article

< Previous Page | 141 142 143 144 145 146 147 148 149 150 151 152  | Next Page >