Search Results

Search found 16772 results on 671 pages for 'charles long'.

Page 15/671 | < Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >

  • difference between C(gcc 4.3.2) , C 99 strict(gcc 4.3.2) , C++(gcc-4.0.0-8) ,C++(gcc-4.3.2)

    - by user1139048
    I have the following questions concerning the differences between the four options: What is the main difference between the four options? Which of the above support int64_t or long long without suffix LL. I want a data type of the range 2^63 - 1 If your answer to my second question is not C(gcc 4.3.2) , whether the code I write in C(gcc 4.3.2) for C language will be valid in rest of the three options or do I have to modify something, then what will be those modifications.

    Read the article

  • Long variable names

    - by RaouL
    Lets say i have a variable that contains the number of search engine names in a file, what would you name it? number_of_seach_engine_names search_engine_name_count num_search_engines engines engine_names other name? The first name describes what the variable contains precisely, but isn't it too long?, any advice for choosing variable names? especially how to shorten a name that is too long or what kind of abbreviations to use?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • strict string to int[long]

    - by baskin
    Do we have a standard way of converting a char* to int (or long) in a strict way, i.e. we should get proper result only if all characters are digits and can fit in an int (or long) -- some way by using strtol etc.. ? Thus "sbc45", "4590k", " 56", "56 ", should be all invalid using that function.

    Read the article

  • Cannot convert object, recieved from ajax call, into a long

    - by Matt
    I'm using Asp.Net-Mvc, I have this method in my controller: [AcceptVerbs(HttpVerbs.Post)] public ActionResult LinkAccount(string site, object id) { return this.Json(id); } Here's the ajax method that calls it: $.post("/Account/LinkAccount", { site: "Facebook", id: FB.Facebook.apiClient.get_session().uid }, function(result) { alert(result); }, "json" ); returning this.Json(id); makes the alert work... it alerts 7128383 (something similar to that). but if I change this.Json(id) to this.Json(Conver.ToInt64(id)); the alert does not fire... Any idea of why I can't convert an object received from an object to a long? I already know changing the LinkAccount method to accept a long instead works just fine. It's just I need it as an object because some other sites I'm linking up have strings for id's rather than longs. UPDATE: I tried running the code on localhost so I could set a breakpoint. First I changed the line return this.Json(Convert.ToInt64(id)); to long idAsLong = Convert.ToInt64(id));. Here's what the debugger is telling me: When I hover over id it says: "id | {string[1]}" and when I press the plus button is shows: "[0] | '7128383'" When I hover over idAsLong, it says: "idAsLong | 0" Why isn't it converting it properly?

    Read the article

  • NSURLConnection receives data even if no data was thrown back

    - by Anna Fortuna
    Let me explain my situation. Currently, I am experimenting long-polling using NSURLConnection. I found this and I decided to try it. What I do is send a request to the server with a timeout interval of 300 secs. (or 5 mins.) Here is a code snippet: NSURL *url = [NSURL URLWithString:urlString]; NSURLRequest *request = [NSURLRequest requestWithURL:url cachePolicy:NSURLCacheStorageAllowedInMemoryOnly timeoutInterval:300]; NSData *data = [NSURLConnection sendSynchronousRequest:request returningResponse:&resp error:&err]; Now I want to test if the connection will "hold" the request if no data was thrown back from the server, so what I did was this: if (data != nil) [self performSelectorOnMainThread:@selector(dataReceived:) withObject:data waitUntilDone:YES]; And the function dataReceived: looks like this: - (void)dataReceived:(NSData *)data { NSLog(@"DATA RECEIVED!"); NSString *string = [NSString stringWithUTF8String:[data bytes]]; NSLog(@"THE DATA: %@", string); } Server-side, I created a function that will return a data once it fits the arguments and returns none if nothing fits. Here is a snippet of the PHP function: function retrieveMessages($vardata) { if (!empty($vardata)) { $result = check_data($vardata) //check_data is the function which returns 1 if $vardata //fits the arguments, and 0 if it fails to fit if ($result == 1) { $jsonArray = array('Data' => $vardata); echo json_encode($jsonArray); } } } As you can see, the function will only return data if the $result is equal to 1. However, even if the function returns nothing, NSURLConnection will still perform the function dataReceived: meaning the NSURLConnection still receives data, albeit an empty one. So can anyone help me here? How will I perform long-polling using NSURLConnection? Basically, I want to maintain the connection as long as no data is returned. So how will I do it? NOTE: I am new to PHP, so if my code is wrong, please point it out so I can correct it.

    Read the article

  • Short names versus long names in Windows

    - by normski
    I have some code which gets the short name from a file path, using GetShortNameW(), and then later retrieves the long name view GetLongNameA(). The original file is of the form "C:/ProgramData/My Folder/File.ext" However, following conversion to short, then back to long, the filename becomes "C:/Program Files/My Folder/Filename.ext". The short name is of the form "C:/PROGRA~2/MY_FOL~1/FIL~1.EXT" The short name is being incorrectly resolved. The code compiles using VS 2005 on Windows 7 (I cannot upgrade the project to VS2008) Does anybody have any idea why this might be happening? DWORD pathLengthNeeded = ::GetShortPathNameW(aRef->GetFilePath().c_str(), NULL, 0); if(pathLengthNeeded != 0) { WCHAR* shortPath = new WCHAR[pathLengthNeeded]; DWORD newPathNameLength = ::GetShortPathNameW(aRef->GetFilePath().c_str(), shortPath, pathLengthNeeded); if(newPathNameLength != 0) { UI_STRING unicodePath(shortPath); std::string asciiPath = StringFromUserString(unicodePath); pathLengthNeeded = ::GetLongPathNameA(asciiPath.c_str(),NULL, 0); if(pathLengthNeeded != 0) {// convert it back to a long path if possible. For goodness sake can't we use Unicode throughout?F char* longPath = new char[pathLengthNeeded]; DWORD newPathNameLength = ::GetLongPathNameA(asciiPath.c_str(), longPath, pathLengthNeeded); if(newPathNameLength != 0) { std::string longPathString(longPath, newPathNameLength); asciiPath = longPathString; } delete [] longPath; } SetFullPathName(asciiPath); } delete [] shortPath; }

    Read the article

  • reshaping a data frame into long format in R

    - by user1773115
    I'm struggling with a reshape in R. I have 2 types of error (err and rel_err) that have been calculated for 3 different models. This gives me a total of 6 error variables (i.e. err_1, err_2, err_3, rel_err_1, rel_err_2, and rel_err_3). For each of these types of error I have 3 different types of predivtive validity tests (ie random holdouts, backcast, forecast). I would like to make my data set long so I keep the 4 types of test long while also making the two error measurements long. So in the end I will have one variable called err and one called rel_err as well as an id variable for what model the error corresponds to (1,2,or 3) Here is my data right now: iter err_1 rel_err_1 err_2 rel_err_2 err_3 rel_err_3 test_type 1 -0.09385732 -0.2235443 -0.1216982 -0.2898543 -0.1058366 -0.2520759 random 1 0.16141630 0.8575728 0.1418732 0.7537442 0.1584816 0.8419816 back 1 0.16376930 0.8700738 0.1431505 0.7605302 0.1596502 0.8481901 front 1 0.14345986 0.6765194 0.1213689 0.5723444 0.1374676 0.6482615 random 1 0.15890059 0.7435382 0.1589823 0.7439204 0.1608709 0.7527580 back 1 0.14412360 0.6743928 0.1442039 0.6747684 0.1463520 0.6848202 front and here is what I would like it to look like: iter model err rel_err test_type 1 1 -0.09385732 (#'s) random 1 2 -0.1216982 (#'s) random 1 3 -0.1216982 (#'s) random and on... I've tried playing around with the syntax but can't quite figure out what to put for the time.varying argument Thanks very much for any help you can offer.

    Read the article

  • Short file names versus long file names in Windows

    - by normski
    I have some code which gets the short name from a file path, using GetShortNameW(), and then later retrieves the long name view GetLongNameA(). The original file is of the form "C:/ProgramData/My Folder/File.ext" However, following conversion to short, then back to long, the filename becomes "C:/Program Files/My Folder/Filename.ext". The short name is of the form "C:/PROGRA~2/MY_FOL~1/FIL~1.EXT" The short name is being incorrectly resolved. The code compiles using VS 2005 on Windows 7 (I cannot upgrade the project to VS2008) Does anybody have any idea why this might be happening? DWORD pathLengthNeeded = ::GetShortPathNameW(aRef->GetFilePath().c_str(), NULL, 0); if(pathLengthNeeded != 0) { WCHAR* shortPath = new WCHAR[pathLengthNeeded]; DWORD newPathNameLength = ::GetShortPathNameW(aRef->GetFilePath().c_str(), shortPath, pathLengthNeeded); if(newPathNameLength != 0) { UI_STRING unicodePath(shortPath); std::string asciiPath = StringFromUserString(unicodePath); pathLengthNeeded = ::GetLongPathNameA(asciiPath.c_str(),NULL, 0); if(pathLengthNeeded != 0) {// convert it back to a long path if possible. For goodness sake can't we use Unicode throughout?F char* longPath = new char[pathLengthNeeded]; DWORD newPathNameLength = ::GetLongPathNameA(asciiPath.c_str(), longPath, pathLengthNeeded); if(newPathNameLength != 0) { std::string longPathString(longPath, newPathNameLength); asciiPath = longPathString; } delete [] longPath; } SetFullPathName(asciiPath); } delete [] shortPath; }

    Read the article

  • Is long long in C++ known to be very nasty in terms of precision?

    - by Kevin
    The Given Problem: Given a theater with n rows, m seats, and a list of seats that are reserved. Given these values, determine how many ways two friends can sit together in the same row. So, if the theater was a size of 2x3 and the very first seat in the first row was reserved, there would be 3 different seatings that these two guys can take. The Problem That I'm Dealing With The function itself is supposed to return the number of seatings that there are based on these constraints. The return value is a long long. I've gone through my code many many times...and I'm pretty sure that it's right. All I'm doing is incrementing this one value. However, ALL of the values that my function return differ from the actual solution by 1 or 2. Any ideas? And if you think that it's just something wrong with my code, please tell me. I don't mind being called an idiot just as long as I learn something.

    Read the article

  • Compat Wireless Drivers Centrino N-2230

    - by user2699451
    So I am using linux and am having trouble installing the Compat Wireless drivers Hardware: Intel Centrino N-2230 OS: Linux Mint 64bit (kernel 13.08-generic) I followed this link http://www.mathyvanhoef.com/2012/09/compat-wireless-injection-patch-for.html Output: apt-get install linux-headers-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done linux-headers-3.8.0-19-generic is already the newest version. 0 upgraded, 0 newly installed, 0 to remove and 19 not upgraded. charles-W55xEU compat-wireless-2010-10-16 # cd ~ charles-W55xEU ~ # dir adt-bundle-linux-x86_64-20130917.zip Desktop known_hosts_backup charles-W55xEU ~ # wget http://www.orbit-lab.org/kernel/compat-wireless-3-stable/v3.6/compat-wireless-3.6.2-1-snp.tar.bz2 --2013-10-29 10:28:23-- http://www.orbit-lab.org/kernel/compat-wireless-3-stable/v3.6/compat-wireless-3.6.2-1-snp.tar.bz2 Resolving www.orbit-lab.org (www.orbit-lab.org)... 128.6.192.131 Connecting to www.orbit-lab.org (www.orbit-lab.org)|128.6.192.131|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 4443700 (4,2M) [application/x-bzip2] Saving to: ‘compat-wireless-3.6.2-1-snp.tar.bz2’ 100%[======================================>] 4 443 700 13,5KB/s in 11m 3s 2013-10-29 10:39:27 (6,55 KB/s) - ‘compat-wireless-3.6.2-1-snp.tar.bz2’ saved [4443700/4443700] charles-W55xEU ~ # tar -xf compat-wireless-3.6.2-1-snp.tar.bz2 charles-W55xEU ~ # cd compat-wireless-3.6-rc6-1 bash: cd: compat-wireless-3.6-rc6-1: No such file or directory charles-W55xEU ~ # dir adt-bundle-linux-x86_64-20130917.zip Desktop compat-wireless-3.6.2-1-snp known_hosts_backup compat-wireless-3.6.2-1-snp.tar.bz2 charles-W55xEU ~ # cd compat-wireless-3.6.2-1-snp/ charles-W55xEU compat-wireless-3.6.2-1-snp # dir code-metrics.txt defconfigs linux-next-pending pending-stable compat drivers MAINTAINERS README config.mk enable-older-kernels Makefile scripts COPYRIGHT include net udev crap linux-next-cherry-picks patches charles-W55xEU compat-wireless-3.6.2-1-snp # wget http://patches.aircrack-ng.org/mac80211.compat08082009.wl_frag+ack_v1.patch --2013-10-29 10:40:52-- http://patches.aircrack-ng.org/mac80211.compat08082009.wl_frag+ack_v1.patch Resolving patches.aircrack-ng.org (patches.aircrack-ng.org)... 213.186.33.2, 2001:41d0:1:1b00:213:186:33:2 Connecting to patches.aircrack-ng.org (patches.aircrack-ng.org)|213.186.33.2|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 1049 (1,0K) [text/plain] Saving to: ‘mac80211.compat08082009.wl_frag+ack_v1.patch’ 100%[======================================>] 1 049 --.-K/s in 0s 2013-10-29 10:40:56 (180 MB/s) - ‘mac80211.compat08082009.wl_frag+ack_v1.patch’ saved [1049/1049] charles-W55xEU compat-wireless-3.6.2-1-snp # patch -p1 < mac80211.compat08082009.wl_frag+ack_v1.patch patching file net/mac80211/tx.c Hunk #1 succeeded at 792 (offset 115 lines). charles-W55xEU compat-wireless-3.6.2-1-snp # wget -Ocompatwireless_chan_qos_frag.patch http://pastie.textmate.org/pastes/4882675/download --2013-10-29 10:43:18-- http://pastie.textmate.org/pastes/4882675/download Resolving pastie.textmate.org (pastie.textmate.org)... 178.79.137.125 Connecting to pastie.textmate.org (pastie.textmate.org)|178.79.137.125|:80... connected. HTTP request sent, awaiting response... 301 Moved Permanently Location: http://pastie.org/pastes/4882675/download [following] --2013-10-29 10:43:20-- http://pastie.org/pastes/4882675/download Resolving pastie.org (pastie.org)... 96.126.119.119 Connecting to pastie.org (pastie.org)|96.126.119.119|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 2036 (2,0K) [application/octet-stream] Saving to: ‘compatwireless_chan_qos_frag.patch’ 100%[======================================>] 2 036 --.-K/s in 0,001s 2013-10-29 10:43:21 (3,35 MB/s) - ‘compatwireless_chan_qos_frag.patch’ saved [2036/2036] charles-W55xEU compat-wireless-3.6.2-1-snp # patch -p1 < compatwireless_chan_qos_frag.patch patching file drivers/net/wireless/rtl818x/rtl8187/dev.c patching file net/mac80211/tx.c Hunk #1 succeeded at 1495 (offset 8 lines). patching file net/wireless/chan.c charles-W55xEU compat-wireless-3.6.2-1-snp # make ./scripts/gen-compat-autoconf.sh /root/compat-wireless-3.6.2-1-snp/.config /root/compat-wireless-3.6.2-1-snp/config.mk > include/linux/compat_autoconf.h make -C /lib/modules/3.8.0-19-generic/build M=/root/compat-wireless-3.6.2-1-snp modules make[1]: Entering directory `/usr/src/linux-headers-3.8.0-19-generic' CC [M] /root/compat-wireless-3.6.2-1-snp/compat/main.o LD [M] /root/compat-wireless-3.6.2-1-snp/compat/compat.o CC [M] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:8:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_pci.h:217:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_pci_init’ In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:10:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_gmac_cmn.h:95:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_gmac_cmn_init’ In file included from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8:0: /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:25:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:152:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:17:21: warning: ‘bcma_bus_next_num’ defined but not used [-Wunused-variable] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:93:12: warning: ‘bcma_register_cores’ defined but not used [-Wunused-function] make[3]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o] Error 1 make[2]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma] Error 2 make[1]: *** [_module_/root/compat-wireless-3.6.2-1-snp] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.8.0-19-generic' make: *** [modules] Error 2 charles-W55xEU compat-wireless-3.6.2-1-snp # make install Warning: You may or may not need to update your initframfs, you should if any of the modules installed are part of your initramfs. To add support for your distribution to do this automatically send a patch against ./scripts/update-initramfs. If your distribution does not require this send a patch against the '/usr/bin/lsb_release -i -s': LinuxMint tag for your distribution to avoid this warning. make -C /lib/modules/3.8.0-19-generic/build M=/root/compat-wireless-3.6.2-1-snp modules make[1]: Entering directory `/usr/src/linux-headers-3.8.0-19-generic' CC [M] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:8:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_pci.h:217:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_pci_init’ In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:10:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_gmac_cmn.h:95:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_gmac_cmn_init’ In file included from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8:0: /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:25:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:152:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:17:21: warning: ‘bcma_bus_next_num’ defined but not used [-Wunused-variable] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:93:12: warning: ‘bcma_register_cores’ defined but not used [-Wunused-function] make[3]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o] Error 1 make[2]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma] Error 2 make[1]: *** [_module_/root/compat-wireless-3.6.2-1-snp] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.8.0-19-generic' make: *** [modules] Error 2 charles-W55xEU compat-wireless-3.6.2-1-snp # It keeps giving errors, same with other sites, I get the same errors??? I am lost, help needed

    Read the article

  • wpf window refresh works at first, then stops

    - by mcl
    I've got a routine that grabs a list of all images in a directory, then runs an MD5 digest on all of them. Since this takes a while to do, I pop up a window with a progress bar. The progress bar is updated by a lambda that I pass in to the long-running routine. The first problem was that the progress window was never updated (which is normal in WPF I guess). Since WPF lacks a Refresh() command I fixed this with a call to Dispatcher.Invoke(). Now the progress bar is updated for a while, then the window stops being updated. The long-running work does eventually finish and the windows go back to normal. I have already tried a BackgroundWorker and quickly became frustrated by a threading issue related to an event triggered by the long-running process. So if that's really the best solution and I just need to learn the paradigm better, please say so. But I'd be really much happier with the approach I've got here, except that it stops updating after a bit (for example, in a folder with 1000 files, it might update for 50-100 files, then "hang"). The UI does not need to be responsive during this activity, except to report on progress. Anyway, here's the code. First the progress window itself: public partial class ProgressWindow : Window { public ProgressWindow(string title, string supertext, string subtext) { InitializeComponent(); this.Title = title; this.SuperText.Text = supertext; this.SubText.Text = subtext; } internal void UpdateProgress(int count, int total) { this.ProgressBar.Maximum = Convert.ToDouble(total); this.ProgressBar.Value = Convert.ToDouble(count); this.SubText.Text = String.Format("{0} of {1} finished", count, total); this.Dispatcher.Invoke(DispatcherPriority.Render, EmptyDelegate); } private static Action EmptyDelegate = delegate() { }; } <Window x:Class="Pixort.ProgressWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="Pixort Progress" Height="128" Width="256" WindowStartupLocation="CenterOwner" WindowStyle="SingleBorderWindow" ResizeMode="NoResize"> <DockPanel> <TextBlock DockPanel.Dock="Top" x:Name="SuperText" TextAlignment="Left" Padding="6"></TextBlock> <TextBlock DockPanel.Dock="Bottom" x:Name="SubText" TextAlignment="Right" Padding="6"></TextBlock> <ProgressBar x:Name="ProgressBar" Height="24" Margin="6"/> </DockPanel> </Window> The long running method (in Gallery.cs): public void ImportFolder(string folderPath, Action<int, int> progressUpdate) { string[] files = this.FileIO.GetFiles(folderPath); for (int i = 0; i < files.Length; i++) { // do stuff with the file if (null != progressUpdate) { progressUpdate.Invoke(i + 1, files.Length); } } } Which is called thusly: ProgressWindow progress = new ProgressWindow("Import Folder Progress", String.Format("Importing {0}", folder), String.Empty); progress.Show(); this.Gallery.ImportFolder(folder, ((c, t) => progress.UpdateProgress(c, t))); progress.Close();

    Read the article

  • Sending Adobe PDF attachments from Adobe Reader (in Outlook 2003) takes too long

    - by White Island
    I have a customer who is using Outlook 2003 (Microsoft Online Services) and Adobe reader 9+. When they send a PDF from Adobe reader to Outlook (via the Send as attachment to e-mail feature in Adobe), it freezes for 30 seconds to 5 minutes before the new e-mail pops up with the PDF attachment. I'm pretty sure the issue is on the Outlook side of things, as I've tried Adobe reader 8 and Foxit Reader with the same results (Windows XP/7 doesn't seem to make a difference, either). I tried Outlook in safe mode on the first (Win7) machine I was working on, and the e-mail attachment worked a lot faster, but when I tried to replicate the results on another machine, one wouldn't go into safe mode, the other didn't seem to show a difference. In an effort to fix the problem in Outlook normal mode, I tried disabling all add-ins, Com add-in (Office Communicator is the only one), reading pane, Word 2003 as e-mail editor... but none of these seemed to address the issue. Does anyone have any other ideas? I need to get this resolved as soon as possible, and it doesn't seem practical to make them run in safe mode. :P

    Read the article

  • Mail server responds with Error 500 line too long

    - by mawimawi
    I am occasionally receiving error messages from mail servers with the above message. It seems that at least one line in the e-mail has more than 999 characters and therefore the e-mail is bounced. Is this "by design"? in an RFC? Or some weird pseudo-spam-filter? Or just a bad mailserver? I googled around a bit but did not find a competent answer. Hopefully one of you guys can enlighten me.

    Read the article

  • MS Office Communicator: Long delays in setting up audio connection when starting a call

    - by geofftnz
    I am using Microsoft Office Communicator with a USB headset as my work phone. OCS is connected to our PABX so we can take and make calls to regular, non-OCS phones. When making an external call to a cellphone, it can take up to 5-10 seconds for audio to start flowing. eg: Work Phone Cellphone - dial cellphone (ringing) (ringing) answer cellphone (hearing nothing) speak "1" . speak "2" . speak "3" . ... . speak "14" hear "15" speak "15" hear "16" speak "16" Has anyone experienced this kind of thing with an OCS setup? Any pointers?

    Read the article

  • Sending Adobe PDF attachments from Adobe Reader (in Outlook 2003) takes too long

    - by White Island
    I have a customer who is using Outlook 2003 (Microsoft Online Services) and Adobe reader 9+. When they send a PDF from Adobe reader to Outlook (via the Send as attachment to e-mail feature in Adobe), it freezes for 30 seconds to 5 minutes before the new e-mail pops up with the PDF attachment. I'm pretty sure the issue is on the Outlook side of things, as I've tried Adobe reader 8 and Foxit Reader with the same results (Windows XP/7 doesn't seem to make a difference, either). I tried Outlook in safe mode on the first (Win7) machine I was working on, and the e-mail attachment worked a lot faster, but when I tried to replicate the results on another machine, one wouldn't go into safe mode, the other didn't seem to show a difference. In an effort to fix the problem in Outlook normal mode, I tried disabling all add-ins, Com add-in (Office Communicator is the only one), reading pane, Word 2003 as e-mail editor... but none of these seemed to address the issue. Does anyone have any other ideas? I need to get this resolved as soon as possible, and it doesn't seem practical to make them run in safe mode. :P

    Read the article

  • SVN checkout/export too long to download

    - by user41671
    Hi, My checkout/export session in svn is kinda weird. The file is just a 300KB in size but the downloading keeps going and it reaches a megabytes in size. The file is in RPM format. I don't know if the file is corrupt or the SVN has a bug. I tried to download the file using web browser and seems the downloading works fine. What probably is the main problem is here?

    Read the article

  • SVN checkout/export too long to download

    - by sasayins
    Hi, My checkout/export session in svn is kinda weird. The file is just a 300KB in size but the downloading keeps going and it reaches a megabytes in size. The file is in RPM format. I don't know if the file is corrupt or the SVN has a bug. I tried to download the file using web browser and seems the downloading works fine. What probably is the main problem is here?

    Read the article

  • Long Gigabit Ethernet Run

    - by Timothy R. Butler
    I am trying to get an Gig-E network between two buildings that are approximately 260 ft. away. While some TRENDnet switches failed to be able to connect to each other over Cat 6 at that distance, two Netgear 5-port Gig-E switches do so just fine. However, it still fails after I put in place APC PNET1GB ethernet surge protectors at each end before the line connects to the respective switches. So I find myself wondering if I simply need to find a better surge protector that doesn't degrade the signal as much (if so, what kind would you recommend?) or if I should give up on copper and use fiber between the buildings. If I opt to go the latter route, I could really use some pointers. It looks like LC connectors are the most common, but I keep running into some others as well. A media converter on each end seems like the simplest solution, but perhaps a Gig-E switch with an SFP port would make more sense? Given a very limited budget, sticking with my existing copper seems best, but if it is bound to be a headache, a 100 meter fiber cable is something I think I can swing cost wise.

    Read the article

  • Shut Down took way too long because of "Background Programs"

    - by Christopher Chipps
    I tried shutting my desktop PC (with Windows7) down but after several attempts (like 4 or 5) at Start -- Shut Down, the GUI was still there and it was not shutting down. I didn't think there were any programs running when I pressed Shut Down, so I went into the taskbar (Ctrl + Alt + Del) to check out the processes. Once I did that, a screen appeared with a message stating that there are "background programs" still running and it gave me an option to "Force Shut Down" which I pressed and it shut down normally. Does anyone know why this would happen?

    Read the article

  • How long do Lithium Ion batteries normally last?

    - by Zifre
    On the laptop I have, I've had to buy a new Li-Ion batter roughly every year. I do use this computer quite a lot, but I'm wondering if this is normal. Right now, my battery is completely dead (it lasts for about 0.1 seconds), so I plan on buying a new one soon. Is there anything you can do to prevent Li-Ion batteries from going dead so quickly?

    Read the article

  • Internet Explorer 9 takes a long time to load websites

    - by Steve
    IE9 on Windows 7 would load Google okay, and we could search on Google okay, but almost any other website would take an inordinate amount of time to load. The loading sprite would sit there indefinitely. I uninstalled IE9 to roll back to IE8, and the same issue occurs. We've reset IE settings back to defaults, and there are no add-ons causing this. Firefox loads websites fine on this computer. Could it be an IE-specific virus/trojan? IE was displaying an incorrect/hijacked home page.

    Read the article

  • Troubleshooting iptables and configuring it to drop the priority of long-term connections

    - by intuited
    I'm somewhat familiar with the general concepts of iptables, and would like to learn it in more detail. I'm hoping that my learning experience can also be useful. The situation: I'm running dd-wrt on my router. Despite its purported QoS skills, I'm still seeing connection latency shoot up hugely whenever there's an ongoing http connection, eg some large download. Under such conditions, it can take 10 seconds or more to load a basic webpage; sometimes the connections are dropped entirely. I've tried adjusting the parameters, dropping the allotted bandwidth for up and download to well under my limit, but nothing seems to work. dd-wrt is configured to use HTB as the QoS algorithm; HFSC, although presented as an option, seems to cause the router to crash, and is rumoured to not actually work on any linux system. I'd like to be able to troubleshoot this issue and hopefully improve the settings that dd-wrt is using, but I'm finding the learning curve a bit overwhelming. For starters I am not sure what HTB actually specifies: is this a set of iptables commands, or do some of those commands specify how HTB is to be used? I would like it to prioritize based on protocol the way that it already supposed to, and in addition I'd like to have it drop the priority of connections which have a high total byte count, say over 400KB. Also tips on utilities that can be run under dd-wrt to get more info on what's going on in there are appreciated. I've tried to get iftop to work but there were issues running curses. I'm leaning towards replacing dd-wrt with openwrt; comments on this strategy are also welcome. I suspect that I would be well advised to get a second router as a standin before trying that. It may be worth noting that my total bandwidth is pretty limited (256Kbit/s).

    Read the article

  • MySQL taking a long time to start

    - by Dscoduc
    I'm running Windows Server 2008 with MySQL installed and every time I reboot the server the MySQL Service doesn't start right away. A look into the Windows Eventlog shows that the MySQL Service was hung at startup. Looking at the Services.msc console shows the service state at Starting... Eventually, like 10 minutes, the MySQL Service actually finishes the startup process and the database becomes available for my Wordpress server... I looked at the MySQL .err files and didn't find anything that would indicate a delay in the statup process... Can anyone suggest a way to determine what is causing the delay, and more importantly, how to prevent the delay in the MySQL Startup? UPDATE: Here is the .err log contents from the shutdown to the startup complete. Notice the startup begins at 10:30:00 and the MySQL isn't ready for connections until 10:47:14, a full 17 minutes later: 100322 10:27:06 [Note] C:\Program Files\MySQL\MySQL Server 5.1\bin\mysqld: Normal shutdown 100322 10:27:06 [Note] Event Scheduler: Purging the queue. 0 events 100322 10:27:06 InnoDB: Starting shutdown... 100322 10:27:08 InnoDB: Shutdown completed; log sequence number 4 3854351346 100322 10:27:08 [Warning] Forcing shutdown of 1 plugins 100322 10:27:08 [Note] C:\Program Files\MySQL\MySQL Server 5.1\bin\mysqld: Shutdown complete 100322 10:30:00 [Note] Plugin 'FEDERATED' is disabled. 100322 10:30:01 InnoDB: Started; log sequence number 4 3854351346 100322 10:47:14 [Note] Event Scheduler: Loaded 0 events 100322 10:47:14 [Note] C:\Program Files\MySQL\MySQL Server 5.1\bin\mysqld: ready for connections. UPDATE 2: MySQL is configured as a service (part of the install process, nothing I did) and executes the following syntax (as it appears in the registry): "C:\Program Files\MySQL\MySQL Server 5.1\bin\mysqld" --defaults-file="C:\Program Files\MySQL\MySQL Server 5.1\my.ini" MySQL

    Read the article

< Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >