Search Results

Search found 9271 results on 371 pages for 'whole foods'.

Page 15/371 | < Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >

  • Window controls missing; Cannot maximise or minimize applications

    - by omg_scout
    Ubuntu 12.10 32 bits, fresh installation. How can I make Unity maximize or minimize a window? I see no button,option, anything, do I miss something big? Quick googling did not give me a piece of answer, too: On first screen, I have a terminal window. Only clue about maximizing it I found was pressing F11 which made it fullscreen, hiding left bar as well. I would prefer it to take whole free space instead of whole screen. How can I do that? On second screen, I have an opera browser which takes bigger part of the screen but I can't make it take whole screen. Restarting opera did not work. How do I minimize/maximize apps? Also, in case I would like to see the desktop, only solution I found was closing everything Help guys. I kind of like new GUI, but I can't have simplest tasks done there, I feel like I miss something big there.

    Read the article

  • css - use universal '*' selector vs. html or body selector?

    - by Michael Durrant
    Applying styles to the body tag will be applied to the whole page, so body { font-family: Verdana } will be applied to the whole page. This could also be done with * {font-family: Verdana} which would apply to all elements and so would seem to have the same effect. I understand the principle that in the first instance the style is being applied to one tag, body for the whole page whereas in the second example the font is being applied against each individual html elements. What I am asking is what is the practical difference in doing that, what are the implications and what is a reason, situation or best practice that leads to using one over another. One side-effect is certainly speed (+1 Rob). I am most interested in the actual reason to choose one over the other in terms of functionality.

    Read the article

  • Not assigning Bugs to a specific user

    - by user2977817
    My question: Is there a benefit to NOT assigning a Bug to a particular developer? Leaving it to the team as-a-whole? Our department has decided to be more Agile by not assigning Bugs/Defects to individuals. Using Team Foundation Server 2012, we'll place all Bugs in a development team's "Area" but leave the "Assigned To" field blank. The idea is that the team will create a Task work item which will be assigned to an individual and the Task will link to the Bug. The Team as a whole will therefore take responsibility for the Bug, not an individual, aligning to Scrum - apparently. I see the down side. The reporting tools built into TFS become less useful when you cannot sort by assigned vs unassigned, let alone sorting by which user Bugs are assigned. Is there a benefit I'm not seeing? Besides encouraging teamwork by putting the responsibility on the team-as-a-whole instead of an individual?

    Read the article

  • Do I need to do an "apt-get update" after adding a PPA?

    - by Sat93
    After adding a new ppa to the repository, is it necessary to update the whole database? By "whole database" I mean is it necessary to update index's of each and every packege? If it's not necessary, then how can I update only that specific package whose ppa I have just added into the repository. For example, if I add an ppa by typing the following in terminal, sudo add-apt-repository ppa:tiheum/equinox then we normally run the following command after it, sudo apt-get update But how can I update the only package which is associated with the above ppa, instead of updating the whole database.

    Read the article

  • Customizing UIPickerView in xcode

    - by Srinivas G
    Hi, I developed an application which consists of UIPickerView....It displays as default size in height of the UIPickerView.I want to display the UIPickerView as 320x480 size(iphone simulator size)..so the whole screen has the picker view without using transorm property,because it will stretched the whole view....its not looking good...even with selection indicator also stretched...I need not stretchable picker view..but need to show the picker view with the whole screen..We can control the width of the UIPickerView..But how can we control the height of the UIPickerView..... Thanks & Regards...

    Read the article

  • Ruby Programming Techniques: simple yet not so simple object manipulation

    - by Shyam
    Hi, I want to create an object, let's say a Pie. class Pie def initialize(name, flavor) @name = name @flavor = flavor end end But a Pie can be divided in 8 pieces, a half or just a whole Pie. For the sake of argument, I would like to know how I could give each Pie object a price per 1/8, 1/4 or per whole. I could do this by doing: class Pie def initialize(name, flavor, price_all, price_half, price_piece) @name = name @flavor = flavor @price_all = price_all @price_half = price_half @price_piece = price_piece end end But now, if I would create fifteen Pie objects, and I would take out randomly some pieces somewhere by using a method such as getPieceOfPie(pie_name) How would I be able to generate the value of all the available pies that are whole and the remaining pieces? Eventually using a method such as: myCurrentInventoryHas(pie_name) # output: 2 whole strawberry pies and 7 pieces. I know, I am a Ruby nuby. Thank you for your answers, comments and help!

    Read the article

  • ASP.NET AJAX Partial Rendering

    - by AJ
    Hello, I have a question about how ASP.NET AJAX partial rendering actually works. Does it: 1) Renders the whole page on the server, transmits the whole page to the client, the client then merges just the area contained in the update panel. 2) Renders the whole page on the server, transmits and merges just the area contained by the update panel. 3) Renders, transmits and merges just the area contained by the update panel. Thanks, AJ

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • When does a PHP script end?

    - by allyourcode
    In my mind, a web app something that runs continuously; therefore, I'm confused by documentation pages that talk about the "end" of a PHP script (eg this one). Such references seem to refer to the end of each web request, but if the script ends there, doesn't that mean that the OS has to setup a whole new process for each request? That seems unlikely, because spinning up a whole new process is expensive, and be very inefficient for the whole site.

    Read the article

  • Sprite Animation in Android with OpenGL ES

    - by lijo john
    How to do a sprite animation in android using OpenGL ES? What i have done : Now I am able to draw a rectangle and apply my texture(Spritesheet) to it What I need to know : Now the rectangle shows the whole sprite sheet as a whole How to show a single action from sprite sheet at a time and make the animation It will be very help full if anyone can share any idea's , links to tutorials and suggestions. Advanced Thanks to All

    Read the article

  • Snap Spiffy Linux Screenshots with Shutter

    <b>LinuxPlanet:</b> "Paul Ferrill introduces us to the Shutter screen grab for Linux application. Shutter offers a simple interface and a whole lot of functionality. including cursor capture, whole Web page capture, and annotations."

    Read the article

  • Keeping the meshes "thickness" the same when scaling an object

    - by user1806687
    I've been bashing my head for the past couple of weeks trying to find a way to help me accomplish, on first look very easy task. So, I got this one object currently made out of 5 cuboids (2 sides, 1 top, 1 bottom, 1 back), this is just for an example, later on there will be whole range of different set ups. Now, the thing is when the user chooses to scale the whole object this is what should happen: X scale: top and bottom cuboids should get scaled by a scale factor, sides should get moved so they are positioned just like they were before(in this case at both ends of top and bottom cuboids), back should get scaled so it fits like before(if I simply scale it by a scale factor it will leave gaps on each side). Y scale: sides should get scaled by a scale factor, top and bottom cuboid should get moved, and back should also get scaled. Z scale: sides, top and bottom cuboids should get scaled, back should get moved. Hope you can help, EDIT: So, I've decided to explain the situation once more, this time more detailed(hopefully). I've also made some pictures of how the scaling should look like, where is the problem and the wrong way of scaling. I this example I will be using a thick walled box, with one face missing, where each wall is made by a cuboid(but later on there will be diffrent shapes of objects, where a one of the face might be roundish, or triangle or even under some angle), scaling will be 2x on X axis. 1.This is how the default object without any scaling applied looks like: http://img856.imageshack.us/img856/4293/defaulttz.png 2.If I scale the whole object(all of the meshes) by some scale factor, the problem becomes that the "thickness" of the object walls also change(which I do not want): http://img822.imageshack.us/img822/9073/wrongwaytoscale.png 3.This is how the correct scaling should look like. Appropriate faces gets caled in this case where the scale is on X axis(top, bottom, back): http://imageshack.us/photo/my-images/163/rightwayxscale1.png/ 4.But the scale factor might not be the same for all object all of the times. In this case the back has to get scaled a bit more or it leaves gaps: http://imageshack.us/photo/my-images/9/problemwhenscaling.png/ 5.If everything goes well this is how the final object should look like: http://imageshack.us/photo/my-images/856/rightwayxscale2.png/ So, as you have might noticed there are quite a bit of things to look out when scaling. I am asking you, if any of you have any idea on how to accomplish this scaling. I have tried whole bunch of things, from scaling all of the object by the same scale factor, to subtracting and adding sizes to get the right size. But nothing I tried worked, if one mesh got scaled correctly then others didnt. Donwload the example object. English is not my first language, so I am really sorry if its hard to understand what I am saying.

    Read the article

  • SDL libraries are missing

    - by user287570
    ~/vidmodel/wvsn-model-omnetpp-v4/geometry/Triangle.o ~/vidmodel/wvsn-model-omnetpp-v4/geometry/Polygon.o ~/vidmodel/wvsn-model-omnetpp-v4/geometry/triangulation.o -Wl,--no-as-needed -Wl,--whole-archive -lSDL -lpng -ljpeg -lz -lSDL_image -Wl,--no-whole-archive -L"/home/sreeram/omnetpp-4.2.2/lib/gcc" -L"/home/sreeram/omnetpp-4.2.2/lib" -loppmain -u _cmdenv_lib -Wl,--no-as-needed -loppcmdenv -loppenvir -loppsim -ldl -lstdc++ /usr/bin/ld: cannot find -lSDL /usr/bin/ld: cannot find -lpng /usr/bin/ld: cannot find -ljpeg /usr/bin/ld: cannot find -lSDL_image collect2: ld returned 1 exit can any one please help me

    Read the article

  • Getting the newest version of Ubuntu from 9.04

    - by user286985
    Okay so im new to this whole linux/ubuntu stuff. I need a step by step answer to how to get the newest version of ubuntu from my 9.04 version on my laptop. I was given this laptop as a gift and im still learning this step by step since i have been useing windows my whole life. I heard that i cant update since i have to go version to version so if someone could tell me how to just install the newest version while running 9.04. Thank you(:

    Read the article

  • LINQ-To-SQL and Mapping Table Deletions

    - by Jake
    I have a many-to-many relationship between two tables, let's say Friends and Foods. If a friend likes a food I stick a row into the FriendsFoods table, like this: ID Friend Food 1 'Tom' 'Pizza' FriendsFoods has a Primary Key 'ID', and two non-null foreign keys 'Friend' and 'Food' to the 'Friends' and 'Foods' tables, respectively. Now suppose I have a Friend tom .NET object corresponding to 'Tom', and Tom no longer likes pizza (what is wrong with him?) FriendsFoods ff = tblFriendsFoods.Where(x => x.Friend.Name == 'Tom' && x.Food.Name == 'Pizza').Single(); tom.FriendsFoods.Remove(ff); pizza.FriendsFoods.Remove(ff); If I try to SubmitChanges() on the DataContext, I get an exception because it attempts to insert a null into the Friend and Food columns in the FriendsFoods table. I'm sure I can put together some kind of convoluted logic to track changes to the FriendsFoods table, intercept SubmitChanges() calls, etc to try and get this to work the way I want, but is there a nice, clean way to remove a Many-To-Many relationship with LINQ-To-SQL?

    Read the article

  • Which Single Source Publishing tools and strategies are available?

    - by Another Registered User
    I'm about to write a 1000-Pages Documentation about a huge programming framework. The goal is to bring this documentation online into an web platform, so that online users can search through it and read it online. At the same time, the text has to be made public in PDF format for download. And at the same time, the whole thing needs to go into a printed book as well (print on demand, they want a giant PDF file with the whole book). The PDF files: The whole content is divided into several chapters. Every chapter will be available as a standalone PDF eBook. And finally, all chapters will be available in one huge printed book. Is LaTeX capable for something like that? Can it be used for Single Source Publishing? Or would I have to take a look at other technologies like DocBook, etc.?

    Read the article

  • forced reformat without login / and bootcamp

    - by debug
    ok.. im pretty good with stuff like this, but I have a question. I have mac mini with 10.5.(x) on one partition, and bootcamp (windows) on the other. My boss wants me to reformat the whole mac (10.6 (x)), which is usually easy. He does not remember his password to login, which means I cannot log in and allocate the bootcamp back to one partition using Disk Utility, then reformat the whole drive. When I insert the Snow leopard CD, I can only wipe out one partition, my question is: Is there a way to force a wipe out of both drives in the boot sequence? Any help to wipe out this whole drive and do a clean install would be helpful.. Thanks superusers!

    Read the article

  • How does MySQL 5.5 and InnoDB on Linux use RAM?

    - by Loren
    Does MySQL 5.5 InnoDB keep indexes in memory and tables on disk? Does it ever do it's own in-memory caching of part or whole tables? Or does it completely rely on the OS page cache (I'm guessing that it does since Facebook's SSD cache that was built for MySQL was done at the OS-level: https://github.com/facebook/flashcache/)? Does Linux by default use all of the available RAM for the page cache? So if RAM size exceeds table size + memory used by processes, then when MySQL server starts and reads the whole table for the first time it will be from disk, and from that point on the whole table is in RAM? So using Alchemy Database (SQL on top of Redis, everything always in RAM: http://code.google.com/p/alchemydatabase/) shouldn't be much faster than MySQL, given the same size RAM and database?

    Read the article

  • Command to see all Windows commands

    - by open_sourse
    When I type help in windows command line, it lists a whole bunch of commands. However I find that there is a whole set of commands that do not appear in this list, for e.g. many networking commands such as ping, tracert, arp, netstat, net etc. I am sure that there is also a whole bunch of non-networking command which is also not listed. So my question is this. Why are these additional commands not shown in help? Is there a subset/group of commands only that help shows? Is there any command/method to list all the commands that can be executed in windows? (I am not talking about additional .exes that get added to path when some new software is installed..)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How do I restore a backup of my keyring (containing ssh key passprases, nautilus remote filesystem passwords and wifi passwords)?

    - by con-f-use
    I changed the disk on my laptop and installed Ubuntu on the new disk. Old disk had 12.04 upgraded to 12.10 on it. Now I want to copy my old keyring with WiFi passwords, ftp passwords for nautilus and ssh key passphrases. I have the whole data from the old disk available (is now a USB disk and I did not delete the old data yet or do anything with it - I could still put it in the laptop and boot from it like nothing happend). The old methods of just copying ~/.gconf/... and ~/.gnome2/keyrings won't work. Did I miss something? 1. Edit: I figure one needs to copy files not located in the users home directory as well. I copied the whole old /home/confus (which is my home directory) to the fresh install to no effect. That whole copy is now reverted to the fresh install's home directory, so my /home/confus is as it was the after fresh install. 2. Edit: The folder /etc/NetworkManager/system-connections seems to be the place for WiFi passwords. Could be that /usr/share/keyrings is important as well for ssh keys - that's the only sensible thing that a search came up with: find /usr/ -name "*keyring* 3. Edit: Still no ssh and ftp passwords from the keyring. What I did: Convert old hard drive to usb drive Put new drive in the laptop and installed fresh version of 12.10 there Booted from old hdd via USB and copied its /etc/NetwrokManager/system-connections, ~/.gconf/ and ~/.gnome2/keyrings, ~/.ssh over to the new disk. Confirmed that all keys on the old install work Booted from new disk Result: No passphrase for ssh keys, no ftp passwords in keyring. At least the WiFi passwords are migrated.

    Read the article

< Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >