Search Results

Search found 3841 results on 154 pages for 'daily deals india'.

Page 150/154 | < Previous Page | 146 147 148 149 150 151 152 153 154  | Next Page >

  • Why Is Faulty Behaviour In The .NET Framework Not Fixed?

    - by Alois Kraus
    Here is the scenario: You have a Windows Form Application that calls a method via Invoke or BeginInvoke which throws exceptions. Now you want to find out where the error did occur and how the method has been called. Here is the output we do get when we call Begin/EndInvoke or simply Invoke The actual code that was executed was like this:         private void cInvoke_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.Invoke);         }            [MethodImpl(MethodImplOptions.NoInlining)]         void InvokingFunction(CallMode mode)         {             switch (mode)             {                 case CallMode.Invoke:                     this.Invoke(new MethodInvoker(GenerateError));   The faulting method is called GenerateError which does throw a NotImplementedException exception and wraps it in a NotSupportedException.           [MethodImpl(MethodImplOptions.NoInlining)]         void GenerateError()         {             F1();         }           private void F1()         {             try             {                 F2();             }             catch (Exception ex)             {                 throw new NotSupportedException("Outer Exception", ex);             }         }           private void F2()         {            throw new NotImplementedException("Inner Exception");         } It is clear that the method F2 and F1 did actually throw these exceptions but we do not see them in the call stack. If we directly call the InvokingFunction and catch and print the exception we can find out very easily how we did get into this situation. We see methods F1,F2,GenerateError and InvokingFunction directly in the stack trace and we see that actually two exceptions did occur. Here is for comparison what we get from Invoke/EndInvoke System.NotImplementedException: Inner Exception     StackTrace:    at System.Windows.Forms.Control.MarshaledInvoke(Control caller, Delegate method, Object[] args, Boolean synchronous)     at System.Windows.Forms.Control.Invoke(Delegate method, Object[] args)     at WindowsFormsApplication1.AppForm.InvokingFunction(CallMode mode)     at WindowsFormsApplication1.AppForm.cInvoke_Click(Object sender, EventArgs e)     at System.Windows.Forms.Control.OnClick(EventArgs e)     at System.Windows.Forms.Button.OnClick(EventArgs e) The exception message is kept but the stack starts running from our Invoke call and not from the faulting method F2. We have therefore no clue where this exception did occur! The stack starts running at the method MarshaledInvoke because the exception is rethrown with the throw catchedException which resets the stack trace. That is bad but things are even worse because if previously lets say 5 exceptions did occur .NET will return only the first (innermost) exception. That does mean that we do not only loose the original call stack but all other exceptions and all data contained therein as well. It is a pity that MS does know about this and simply closes this issue as not important. Programmers will play a lot more around with threads than before thanks to TPL, PLINQ that do come with .NET 4. Multithreading is hyped quit a lot in the press and everybody wants to use threads. But if the .NET Framework makes it nearly impossible to track down the easiest UI multithreading issue I have a problem with that. The problem has been reported but obviously not been solved. .NET 4 Beta 2 did not have changed that dreaded GetBaseException call in MarshaledInvoke to return only the innermost exception of the complete exception stack. It is really time to fix this. WPF on the other hand does the right thing and wraps the exceptions inside a TargetInvocationException which makes much more sense. But Not everybody uses WPF for its daily work and Windows forms applications will still be used for a long time. Below is the code to repro the issues shown and how the exceptions can be rendered in a meaningful way. The default Exception.ToString implementation generates a hard to interpret stack if several nested exceptions did occur. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.Threading; using System.Globalization; using System.Runtime.CompilerServices;   namespace WindowsFormsApplication1 {     public partial class AppForm : Form     {         enum CallMode         {             Direct = 0,             BeginInvoke = 1,             Invoke = 2         };           public AppForm()         {             InitializeComponent();             Thread.CurrentThread.CurrentUICulture = CultureInfo.InvariantCulture;             Application.ThreadException += new System.Threading.ThreadExceptionEventHandler(Application_ThreadException);         }           void Application_ThreadException(object sender, System.Threading.ThreadExceptionEventArgs e)         {             cOutput.Text = PrintException(e.Exception, 0, null).ToString();         }           private void cDirectUnhandled_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.Direct);         }           private void cDirectCall_Click(object sender, EventArgs e)         {             try             {                 InvokingFunction(CallMode.Direct);             }             catch (Exception ex)             {                 cOutput.Text = PrintException(ex, 0, null).ToString();             }         }           private void cInvoke_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.Invoke);         }           private void cBeginInvokeCall_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.BeginInvoke);         }           [MethodImpl(MethodImplOptions.NoInlining)]         void InvokingFunction(CallMode mode)         {             switch (mode)             {                 case CallMode.Direct:                     GenerateError();                     break;                 case CallMode.Invoke:                     this.Invoke(new MethodInvoker(GenerateError));                     break;                 case CallMode.BeginInvoke:                     IAsyncResult res = this.BeginInvoke(new MethodInvoker(GenerateError));                     this.EndInvoke(res);                     break;             }         }           [MethodImpl(MethodImplOptions.NoInlining)]         void GenerateError()         {             F1();         }           private void F1()         {             try             {                 F2();             }             catch (Exception ex)             {                 throw new NotSupportedException("Outer Exception", ex);             }         }           private void F2()         {            throw new NotImplementedException("Inner Exception");         }           StringBuilder PrintException(Exception ex, int identLevel, StringBuilder sb)         {             StringBuilder builtStr = sb;             if( builtStr == null )                 builtStr = new StringBuilder();               if( ex == null )                 return builtStr;                 WriteLine(builtStr, String.Format("{0}: {1}", ex.GetType().FullName, ex.Message), identLevel);             WriteLine(builtStr, String.Format("StackTrace: {0}", ShortenStack(ex.StackTrace)), identLevel + 1);             builtStr.AppendLine();               return PrintException(ex.InnerException, ++identLevel, builtStr);         }               void WriteLine(StringBuilder sb, string msg, int identLevel)         {             foreach (string trimmedLine in SplitToLines(msg)                                            .Select( (line) => line.Trim()) )             {                 for (int i = 0; i < identLevel; i++)                     sb.Append('\t');                 sb.Append(trimmedLine);                 sb.AppendLine();             }         }           string ShortenStack(string stack)         {             int nonAppFrames = 0;             // Skip stack frames not part of our app but include two foreign frames and skip the rest             // If our stack frame is encountered reset counter to 0             return SplitToLines(stack)                               .Where((line) =>                               {                                   nonAppFrames = line.Contains("WindowsFormsApplication1") ? 0 : nonAppFrames + 1;                                   return nonAppFrames < 3;                               })                              .Select((line) => line)                              .Aggregate("", (current, line) => current + line + Environment.NewLine);         }           static char[] NewLines = Environment.NewLine.ToCharArray();         string[] SplitToLines(string str)         {             return str.Split(NewLines, StringSplitOptions.RemoveEmptyEntries);         }     } }

    Read the article

  • Curing the Database-Application mismatch

    - by Phil Factor
    If an application requires access to a database, then you have to be able to deploy it so as to be version-compatible with the database, in phase. If you can deploy both together, then the application and database must normally be deployed at the same version in which they, together, passed integration and functional testing.  When a single database supports more than one application, then the problem gets more interesting. I’ll need to be more precise here. It is actually the application-interface definition of the database that needs to be in a compatible ‘version’.  Most databases that get into production have no separate application-interface; in other words they are ‘close-coupled’.  For this vast majority, the whole database is the application-interface, and applications are free to wander through the bowels of the database scot-free.  If you’ve spurned the perceived wisdom of application architects to have a defined application-interface within the database that is based on views and stored procedures, any version-mismatch will be as sensitive as a kitten.  A team that creates an application that makes direct access to base tables in a database will have to put a lot of energy into keeping Database and Application in sync, to say nothing of having to tackle issues such as security and audit. It is not the obvious route to development nirvana. I’ve been in countless tense meetings with application developers who initially bridle instinctively at the apparent restrictions of being ‘banned’ from the base tables or routines of a database.  There is no good technical reason for needing that sort of access that I’ve ever come across.  Everything that the application wants can be delivered via a set of views and procedures, and with far less pain for all concerned: This is the application-interface.  If more than zero developers are creating a database-driven application, then the project will benefit from the loose-coupling that an application interface brings. What is important here is that the database development role is separated from the application development role, even if it is the same developer performing both roles. The idea of an application-interface with a database is as old as I can remember. The big corporate or government databases generally supported several applications, and there was little option. When a new application wanted access to an existing corporate database, the developers, and myself as technical architect, would have to meet with hatchet-faced DBAs and production staff to work out an interface. Sure, they would talk up the effort involved for budgetary reasons, but it was routine work, because it decoupled the database from its supporting applications. We’d be given our own stored procedures. One of them, I still remember, had ninety-two parameters. All database access was encapsulated in one application-module. If you have a stable defined application-interface with the database (Yes, one for each application usually) you need to keep the external definitions of the components of this interface in version control, linked with the application source,  and carefully track and negotiate any changes between database developers and application developers.  Essentially, the application development team owns the interface definition, and the onus is on the Database developers to implement it and maintain it, in conformance.  Internally, the database can then make all sorts of changes and refactoring, as long as source control is maintained.  If the application interface passes all the comprehensive integration and functional tests for the particular version they were designed for, nothing is broken. Your performance-testing can ‘hang’ on the same interface, since databases are judged on the performance of the application, not an ‘internal’ database process. The database developers have responsibility for maintaining the application-interface, but not its definition,  as they refactor the database. This is easily tested on a daily basis since the tests are normally automated. In this setting, the deployment can proceed if the more stable application-interface, rather than the continuously-changing database, passes all tests for the version of the application. Normally, if all goes well, a database with a well-designed application interface can evolve gracefully without changing the external appearance of the interface, and this is confirmed by integration tests that check the interface, and which hopefully don’t need to be altered at all often.  If the application is rapidly changing its ‘domain model’  in the light of an increased understanding of the application domain, then it can change the interface definitions and the database developers need only implement the interface rather than refactor the underlying database.  The test team will also have to redo the functional and integration tests which are, of course ‘written to’ the definition.  The Database developers will find it easier if these tests are done before their re-wiring  job to implement the new interface. If, at the other extreme, an application receives no further development work but survives unchanged, the database can continue to change and develop to keep pace with the requirements of the other applications it supports, and needs only to take care that the application interface is never broken. Testing is easy since your automated scripts to test the interface do not need to change. The database developers will, of course, maintain their own source control for the database, and will be likely to maintain versions for all major releases. However, this will not need to be shared with the applications that the database servers. On the other hand, the definition of the application interfaces should be within the application source. Changes in it have to be subject to change-control procedures, as they will require a chain of tests. Once you allow, instead of an application-interface, an intimate relationship between application and database, we are in the realms of impedance mismatch, over and above the obvious security problems.  Part of this impedance problem is a difference in development practices. Whereas the application has to be regularly built and integrated, this isn’t necessarily the case with the database.  An RDBMS is inherently multi-user and self-integrating. If the developers work together on the database, then a subsequent integration of the database on a staging server doesn’t often bring nasty surprises. A separate database-integration process is only needed if the database is deliberately built in a way that mimics the application development process, but which hampers the normal database-development techniques.  This process is like demanding a official walking with a red flag in front of a motor car.  In order to closely coordinate databases with applications, entire databases have to be ‘versioned’, so that an application version can be matched with a database version to produce a working build without errors.  There is no natural process to ‘version’ databases.  Each development project will have to define a system for maintaining the version level. A curious paradox occurs in development when there is no formal application-interface. When the strains and cracks happen, the extra meetings, bureaucracy, and activity required to maintain accurate deployments looks to IT management like work. They see activity, and it looks good. Work means progress.  Management then smile on the design choices made. In IT, good design work doesn’t necessarily look good, and vice versa.

    Read the article

  • The Business of Winning Innovation: An Exclusive Blog Series

    - by Kerrie Foy
    "The Business of Winning Innovation” is a series of articles authored by Oracle Agile PLM experts on what it takes to make innovation a successful and lucrative competitive advantage. Our customers have proven Agile PLM applications to be enormously flexible and comprehensive, so we’ve launched this article series to showcase some of the most fascinating, value-packed use cases. In this article by Keith Colonna, we kick-off the series by taking a look at the science side of innovation within the Consumer Products industry and how PLM can help companies innovate faster, cheaper, smarter. This article will review how innovation has become the lifeline for growth within consumer products companies and how certain companies are “winning” by creating a competitive advantage for themselves by taking a more enterprise-wide,systematic approach to “innovation”.   Managing the Science of Innovation within the Consumer Products Industry By: Keith Colonna, Value Chain Solution Manager, Oracle The consumer products (CP) industry is very mature and competitive. Most companies within this industry have saturated North America (NA) with their products thus maximizing their NA growth potential. Future growth is expected to come from either expansion outside of North America and/or by way of new ideas and products. Innovation plays an integral role in both of these strategies, whether you’re innovating business processes or the products themselves, and may cause several challenges for the typical CP company, Becoming more innovative is both an art and a science. Most CP companies are very good at the art of coming up with new innovative ideas, but many struggle with perfecting the science aspect that involves the best practice processes that help companies quickly turn ideas into sellable products and services. Symptoms and Causes of Business Pain Struggles associated with the science of innovation show up in a variety of ways, like: · Establishing and storing innovative product ideas and data · Funneling these ideas to the chosen few · Time to market cycle time and on-time launch rates · Success rates, or how often the best idea gets chosen · Imperfect decision making (i.e. the ability to kill projects that are not projected to be winners) · Achieving financial goals · Return on R&D investment · Communicating internally and externally as more outsource partners are added globally · Knowing your new product pipeline and project status These challenges (and others) can be consolidated into three root causes: A lack of visibility Poor data with limited access The inability to truly collaborate enterprise-wide throughout your extended value chain Choose the Right Remedy Product Lifecycle Management (PLM) solutions are uniquely designed to help companies solve these types challenges and their root causes. However, PLM solutions can vary widely in terms of configurability, functionality, time-to-value, etc. Business leaders should evaluate PLM solution in terms of their own business drivers and long-term vision to determine the right fit. Many of these solutions are point solutions that can help you cure only one or two business pains in the short term. Others have been designed to serve other industries with different needs. Then there are those solutions that demo well but are owned by companies that are either unable or unwilling to continuously improve their solution to stay abreast of the ever changing needs of the CP industry to grow through innovation. What the Right PLM Solution Should Do for You Based on more than twenty years working in the CP industry, I recommend investing in a single solution that can help you solve all of the issues associated with the science of innovation in a totally integrated fashion. By integration I mean the (1) integration of the all of the processes associated with the development, maintenance and delivery of your product data, and (2) the integration, or harmonization of this product data with other downstream sources, like ERP, product catalogues and the GS1 Global Data Synchronization Network (or GDSN, which is now a CP industry requirement for doing business with most retailers). The right PLM solution should help you: Increase Revenue. A best practice PLM solution should help a company grow its revenues by consolidating product development cycle-time and helping companies get new and improved products to market sooner. PLM should also eliminate many of the root causes for a product being returned, refused and/or reclaimed (which takes away from top-line growth) by creating an enterprise-wide, collaborative, workflow-driven environment. Reduce Costs. A strong PLM solution should help shave many unnecessary costs that companies typically take for granted. Rationalizing SKU’s, components (ingredients and packaging) and suppliers is a major opportunity at most companies that PLM should help address. A natural outcome of this rationalization is lower direct material spend and a reduction of inventory. Another cost cutting opportunity comes with PLM when it helps companies avoid certain costs associated with process inefficiencies that lead to scrap, rework, excess and obsolete inventory, poor end of life administration, higher cost of quality and regulatory and increased expediting. Mitigate Risk. Risks are the hardest to quantify but can be the most costly to a company. Food safety, recalls, line shutdowns, customer dissatisfaction and, worst of all, the potential tarnishing of your brands are a few of the debilitating risks that CP companies deal with on a daily basis. These risks are so uniquely severe that they require an enterprise PLM solution specifically designed for the CP industry that safeguards product information and processes while still allowing the art of innovation to flourish. Many CP companies have already created a winning advantage by leveraging a single, best practice PLM solution to establish an enterprise-wide, systematic approach to innovation. Oracle’s Answer for the Consumer Products Industry Oracle is dedicated to solving the growth and innovation challenges facing the CP industry. Oracle’s Agile Product Lifecycle Management for Process solution was originally developed with and for CP companies and is driven by a specialized development staff solely focused on maintaining and continuously improving the solution per the latest industry requirements. Agile PLM for Process helps CP companies handle all of the processes associated with managing the science of the innovation process, including: specification management, new product development/project and portfolio management, formulation optimization, supplier management, and quality and regulatory compliance to name a few. And as I mentioned earlier, integration is absolutely critical. Many Oracle CP customers, both with Oracle ERP systems and non-Oracle ERP systems, report benefits from Oracle’s Agile PLM for Process. In future articles we will explain in greater detail how both existing Oracle customers (like Gallo, Smuckers, Land-O-Lakes and Starbucks) and new Oracle customers (like ConAgra, Tyson, McDonalds and Heinz) have all realized the benefits of Agile PLM for Process and its integration to their ERP systems. More to Come Stay tuned for more articles in our blog series “The Business of Winning Innovation.” While we will also feature articles focused on other industries, look forward to more on how Agile PLM for Process addresses innovation challenges facing the CP industry. Additional topics include: Innovation Data Management (IDM), New Product Development (NPD), Product Quality Management (PQM), Menu Management,Private Label Management, and more! . Watch this video for more info about Agile PLM for Process

    Read the article

  • Big Visible Charts

    - by Robert May
    An important part of Agile is the concept of transparency and visibility. In proper functioning teams, stakeholders can look at any team at any time in the iteration or release and see how that team is doing by simply looking at what we call Big Visible Charts. If you’ve done Scrum, you’ve seen these charts. However, interpreting these charts can often be an art form. There are several different charts that can be useful. In this newsletter, I’ll focus on the Iteration Burndown and Cumulative Flow charts. I’ve included a copy of the spreadsheet that I used to create the charts, and if you don’t have a tool that creates them for you, you can use this spreadsheet to do so. Our preferred tool for managing Scrum projects is Rally. Rally creates all of these charts for you, saving you quite a bit of time. The Iteration Burndown and Cumulative Flow Charts This is the main chart that teams use. Although less useful to stakeholders, this chart is critical to the team and provides quite a bit of information to the team about how their iteration is going. Most charts are a combination of the charts below, so you may need to combine aspects of each section to understand what is happening in your iterations. Ideal Ah, isn’t that a pretty picture? Unfortunately, it’s also very unrealistic. I’ve seen iterations that come close to ideal, but never that match perfectly. If your iteration matches perfectly, chances are, someone is playing with the numbers. Reality is just too difficult to have a burndown chart that matches this exactly. Late Planning Iteration started, but the team didn’t. You can tell this by the fact that the real number of estimated hours didn’t appear until day two. In the cumulative flow, you can also see that nothing was defined in Day one and two. You want to avoid situations like this. You’ll note that the team had to burn faster than is ideal to meet the iteration because of the late planning. This often results in long weeks and days. Testing Starved Determining whether or not testing is starved is difficult without the cumulative flow. The pattern in the burndown could be nothing more that developers not completing stories early enough or could be caused by stories being too big. With the cumulative flow, however, you see that only small bites are in progress and stories were completed early, but testing didn’t start testing until the end of the iteration, and didn’t complete testing all stories in the iteration. When this happens, question whether or not your testing resources are sufficient for your team and whether or not acceptance is adequately defined. No Testing With this one, both graphs show the same thing; the team needs testers and testing! Without testing, what was completed cannot be verified to make sure that it is acceptable to the business. If you find yourself in this situation, review your testing practices and acceptance testing process and make changes today. Late Development With this situation, both graphs tell a story. In the top graph, you can see that the hours failed to burn down as quickly as the team expected. This could be caused by the team not correctly estimating their hours or the team could have had illness or some other issue that affected them. Often, when teams are tackling something that is more unknown, they’ll run into technical barriers that cause the burn down to happen slower than expected. In the cumulative flow graph, you can see that not much was completed in the first few days. This could be because of illness or technical barriers or simply poor estimation. Testing was able to keep up with everything that was completed, however. No Tool Updating When you see graphs that look like this, you can be assured that it’s because the team is not updating the tool that generates the graphs. Review your policy for when they are to update. On the teams that I run, I require that each team member updates the tool at least once daily. You should also check to see how well the team is breaking down stories into tasks. If they’re creating few large tasks, graphs can look similar to this. As a general rule, I never allow tasks, other than Unit Testing and Uncertainty, to be greater than eight hours in duration. Scope Increase I always encourage team members to enter in however much time they think they have left on a task, even if that means increasing the total amount of time left to do. You get a much better and more realistic picture this way. Increasing time remaining could explain the burndown graph, but by looking at the cumulative flow graph, we can see that stories were added to the iteration and scope was increased. Since planning should consume all of the hours in the iteration, this is almost always a bad thing. If the scope change happened late in the iteration and the hours remaining were well below the ideal burn, then increasing scope is probably o.k., but estimation needs to get better. However, with the charts above, that’s clearly not what happened and the team was required to do extra work to make the iteration. If you find this happening, your product owner and ScrumMasters need training. The team also needs to learn to say no. Scope Decrease Scope decreases are just as bad as scope increases. Usually, graphs above show that the team did a poor job of estimating their stories and part way through had to reduce scope to change the iteration. This will happen once in a while, but if you find it’s a pattern on your team, you need to re-evaluate planning. Some teams are hopelessly optimistic. In those cases, I’ll introduce a task I call “Uncertainty.” With Uncertainty, the team estimates how many hours they might need if things don’t go well with the tasks they’ve defined. They try to estimate things that could go poorly and increase the time appropriately. Having an Uncertainty task allows them to have a low and high estimate. Uncertainty should not just be an arbitrary buffer. It must correlate to real uncertainty in the tasks that have been defined. Stories are too Big Often, we see graphs like the ones above. Note that the burndown looks fairly good, other than the chunky acceptance of stories. However, when you look at cumulative flow, you can see that at one point, everything is in progress. This is a bad thing. When you see graphs like this, you’re in one of two states. You may just have a very small team and can only handle one or two stories in your iteration. If you have more than one or two people, then the most likely problem is that your stories are far too big. To combat this, break large high hour stories into smaller pieces that can be completed independently and accepted independently. If you don’t, you’ll likely be requiring your testers to do heroic things to complete testing on the last day of the iteration and you’re much more likely to have the entire iteration fail, because of the limited amount of things that can be completed. Summary There are other charts that can be useful when doing scrum. If you don’t have any big visible charts, you really need to evaluate your process and change. These charts can provide the team a wealth of information and help you write better software. If you have any questions about charts that you’re seeing on your team, contact me with a screen capture of the charts and I’ll tell you what I’m seeing in those charts. I always want this information to be useful, so please let me know if you have other questions. Technorati Tags: Agile

    Read the article

  • Master Data

    - by david.butler(at)oracle.com
    Let's take a deeper look at what we mean when we talk about 'Master' data. In its most general sense, master data is data that exists in more than one operational application. These are the applications that automate business processes. These applications require significant amounts of data to function correctly.  This includes data about the objects that are involved in transactions, as well as the transaction data itself.  For example, when a customer buys a product, the transaction is managed by a sales application.  The objects of the transaction are the Customer and the Product.  The transactional data is the time, place, price, discount, payment methods, etc. used at the point of sale. Many thousands of transactional data attributes are needed within the application. These important data elements are local to the applications and have no bearing on other applications. Harmonization and synchronization across applications is not necessary. The Customer and Product objects of the transaction also have a large number of attributes. Customer for example, includes hierarchies, hierarchical and matrixed relationships, contacts, classifications, preferences, accounts, identifiers, profiles, and addresses galore for 'ship to', 'mail to'; 'service at'; etc. Dozens of attributes exist for individuals, hundreds for organizations, and thousands for products. This data has meaning beyond any particular application. It exists in many applications and drives the vital cross application enterprise business processes. These are the processes that define and differentiate the organization. At every decision point, information about the objects of the process determines the direction of the process flow. This is the nature of the data that exists in more than one application, and this is why we call it 'master data'. Let me elaborate. Parties Oracle has developed a party schema to model all participants in your daily business operations. It models people, organizations, groups, customers, contacts, employees, and suppliers. It models their accounts, locations, classifications, and preferences.  And most importantly, it models the vast array of hierarchical and matrixed relationships that exist between all the participants in your real world operations.  The model logically separates people and organizations from their relationships and accounts.  This separation creates flexibility unmatched in the industry and accounts for the fact that the Oracle schema for Customers, Suppliers, and Accounts is a true superset of the wide variety of commercial and homegrown customer models in existence. Sites Sites are places where business is conducted. They can be addresses, clusters such as retail malls, locations within a cluster, floors within a building, places where meters are located, rooms on floors, etc.  Fully understanding all attributes of a site is key to many business processes. Attributes such as 'noise abatement policy' at a point of delivery, or the size of an oven in a business kitchen drive day-to-day activities such as delivery schedules or food promotions. Typically this kind of data is siloed in departments and scattered across applications and spreadsheets.  This leads to conflicting information and poor operational efficiencies. Oracle's Global Single Schema can hold all site attributes in one place and enables a single version of authoritative site information across the enterprise. Products and Services The Oracle Global Single Schema also includes a number of entities that define the products and services a company creates and offers for sale. Key entities include Items organized into Catalogs and Price Lists. The Catalog structures provide for the ability to capture different views of a product such as engineering, manufacturing, and service which are based on a unified product model. As a result, designers, manufacturing engineers, purchasers and partners can work simultaneously on a common product definition. The Catalog schema allows for unlimited attributes, combines them into meaningful groups, and maps them to catalog categories to track these different types of information. The model also maps an unlimited number of functional structures for each item. For example, multiple Bills of Material (BOMs) can be constructed representing requirements BOM, features BOM, and packaging BOM for an item. The Catalog model also supports hierarchical information about each item and all standard Global Data Synchronization attributes. Business Processes Utilizing Linked Data Entities Each business entity codified into a centralized master data environment significantly improves the efficiency of the automated business processes that use the consolidated data.  When all the key business entities used by an organization's process are so consolidated, the advantages are multiplied.  The primary reason for business process breakdowns (i.e. data errors across application boundaries) is eliminated. All processes are positively impacted and business process automation is itself automated.  I like to use the "Call to Resolution" business process as an example to help illustrate this important point. It involves call center applications, service applications, RMA applications, transportation applications, inventory applications, etc. Customer, Site, Product and Supplier master data must all be correct and consistent across these applications.  What's more, the data relationships between customer and product, and product and suppliers must be right. This is the minimum quality needed to insure the business process flows without error. But that is not the end of the story. Critical master data attributes such as customer loyalty, profitability, credit worthiness, and propensity to buy can optimize the call center point of contact component of the process. Critical product information such as alternative parts or equivalent products can optimize the resolution selected by the process. A comprehensive understanding of the 'service at' location can help insure multiple trips are avoided in the process. Full supplier information on reliability, delivery delays, and potential alternates can prevent supplier exceptions and play a significant role in optimizing the process.  In other words, these master data attributes enable the optimization of the "Call to Resolution" enterprise business process. Master data supports and guides business process flows. Thus the phrase 'Master Data' is indeed appropriate. MDM is the software that houses, manages, and governs the master data that resides in all applications and controls the enterprise business processes. A complete master data solution takes a data model that holds fully attributed master data entities and their inter-relationships. Oracle has this model. Oracle, with its deep understanding of application data is the logical choice for managing all your master data within the enterprise whether or not your organization actually runs any Oracle Applications.

    Read the article

  • Son of Suckerfish ie6 problem - right-most dropdown menu also appearing on left side of screen

    - by Kevin Burke
    I'm interning for an NGO in India and trying to fix their website, including updating their menu so it's not the last item on the page to load, and it's centered on the screen. Everything works well enough but when I try out my new menu in IE6, I get this weird error where the content below the menu is padded an extra 30px or so and the material in the right-most drop down appears on the far left of the screen, always visible. When I drop down the rightmost link ("Publications") the content appears both in the correct location and in the same spot on the far left of the screen, and changes color when I hover as well. It's tough to describe, so it would probably be best if you took a look: visit http://sevamandir.org/a30/index.htm in your Internet Explorer 6 browser to see for yourself. I really appreciate your help. Also I'm using a 1000px wide monitor, if there's more hijinks going on outside that space I'd like to know about that too. Here's the relevant code: in the html head: <script> sfHover = function() { var sfEls = document.getElementById("nav").getElementsByTagName("LI"); for (var i=0; i<sfEls.length; i++) { sfEls[i].onmouseover=function() { this.className+=" sfhover"; } sfEls[i].onmouseout=function() { this.className=this.className.replace(new RegExp(" sfhover\\b"), ""); } } } if (window.attachEvent) window.attachEvent("onload", sfHover); </script> text surrounding the menu - the menu is simply <ul id="nav"><li></li></ul> etc. <!--begin catchphrase--> <div style="float:left; height:27px; width:520px; margin:0px; font:16px Arial, Helvetica, sans-serif; font-weight:bold; color:#769841;"> Transforming lives through democratic &amp; participatory development </div> <?php include("menu.php"); ?> </div><!-- end header --> <!--begin main text div--> <div id="maincontent"> Relevant menu CSS: #nav, #nav ul { font:bold 11px Verdana, sans-serif; float: left; width: 980px; list-style: none; line-height: 1; background: white; font-weight: bold; padding: 0; border: solid #769841; border-width: 0; margin: 0 0 1em 0; } #nav a { display: block; width: 140px; /*this is the total width of the upper menu*/ w\idth: 120px; /*this is the width less horizontal padding */ padding: 5px 10px 5px 10px; /*horiz padding is the 2nd & 4th items here - goes Top Right Bottom Left */ color: #ffffff; background:#b6791e; text-decoration: none; } #nav a.daddy { background: url(rightarrow2.gif) center right no-repeat; } #nav li { float: left; padding: 0; width: 140px; /*this needs to be updated to match top #nav a */ background:#b6791e; } #nav li:hover, #nav li a:hover, #nav li:hover a { background:#769841; } #nav li:hover li a { background:#ffffff; color:#769841; } #nav li ul { position: absolute; left: -999em; height: auto; width: 14.4em; w\idth: 13.9em; font-weight: bold; border-width: 0.25em; /*green border around dropdown menu*/ margin: 0; } #nav li ul a { background:#ffffff; color:#769841; } #nav li li { padding-right: 1em; width: 13em; background:#ffffff; } #nav li ul a { width: 13em; w\idth: 9em; } #nav li ul ul { margin: -1.75em 0 0 14em; } #nav li:hover ul ul, #nav li:hover ul ul ul, #nav li.sfhover ul ul, #nav li.sfhover ul ul ul { left: -999em; } #nav li:hover ul, #nav li li:hover ul, #nav li li li:hover ul, #nav li.sfhover ul, #nav li li.sfhover ul, #nav li li li.sfhover ul { left: auto; } #nav li:hover, #nav li.sfhover, { background: #769841; color:#ffe400; } #nav li a:hover, #nav li li a:hover, #nav li:hover li:hover, #nav li.sfhover a:hover { background: #769841; color:#ffe400; }

    Read the article

  • Project Management Helps AmeriCares Deliver International Aid

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Alison Weiss Handle with Care Sound project management helps AmeriCares bring international aid to those in need. The stakes are always high for AmeriCares. On a mission to restore health and save lives during times of disaster, the nonprofit international relief and humanitarian aid organization delivers donated medicines, medical supplies, and humanitarian aid to people in the U.S. and around the globe. Founded in 1982 with the express mission of responding as quickly and efficiently as possible to help people in need, the Stamford, Connecticut-based AmeriCares has delivered more than US$10.5 billion in aid to 147 countries over the past three decades. Launch the Slideshow “It’s critically important to us that we steward all the donations and that the medical supplies and medicines get to people as quickly as possible with no loss,” says Kate Sears, senior vice president for finance and technology at AmeriCares. “Whether we’re shipping IV solutions to victims of cholera in Haiti or antibiotics to Somali famine victims, we need to get the medicines there sooner because it means more people will be helped and lives improved or even saved.” Ten years ago, the tracking systems used by AmeriCares associates were paper-based. In recent years, staff started using spreadsheets, but the tracking processes were not standardized between teams. “Every team was tracking completely different information,” says Megan McDermott, senior associate, Sub-Saharan Africa partnerships, at AmeriCares. “It was just a few key things. For example, we tracked the date a shipment was supposed to arrive and the date we got reports from our partner that a hospital received aid on their end.” While the data was accurate, much detail was being lost in the process. AmeriCares management knew it could do a better job of tracking this enterprise data and in 2011 took a significant step by implementing Oracle’s Primavera P6 Professional Project Management. “It’s a comprehensive solution that has helped us improve the monitoring and controlling processes. It has allowed us to do our distribution better,” says Sears. In addition, the implementation effort has been a change agent, helping AmeriCares leadership rethink project management across the entire organization. Initially, much of the focus was on standardizing processes, but staff members also learned the importance of thinking proactively to prevent possible problems and evaluating results to determine if goals and objectives are truly being met. Such data about process efficiency and overall results is critical not only to AmeriCares staff but also to the donors supporting the organization’s life-saving missions. Efficiency Saves Lives One of AmeriCares’ core operations is to gather product donations from the private sector, establish where the most-urgent needs are, and solicit monetary support to send the aid via ocean cargo or airlift to welfare- and health-oriented nongovernmental organizations, hospitals, health networks, and government ministries based in areas in need. In 2011 alone, AmeriCares sent more than 3,500 shipments to 95 countries in response to both ongoing humanitarian needs and more than two dozen emergencies, including deadly tornadoes and storms in the U.S. and the devastating tsunami in Japan. When it comes to nonprofits in general, donors want to know that the charitable organizations they support are using funds wisely. Typically, nonprofits are evaluated by donors in terms of efficiency, an area where AmeriCares has an excellent reputation: 98 percent of expenses go directly to supporting programs and less than 2 percent represent administrative and fundraising costs. Donors, however, should look at more than simple efficiency, says Peter York, senior partner and chief research and learning officer at TCC Group, a nonprofit consultancy headquartered in New York, New York. They should also look at whether organizations have the systems in place to sustain their missions and continue to thrive. An expert on nonprofit organizational management, York has spent years studying sustainable charitable organizations. He defines them as nonprofits that are able to achieve the ongoing financial support to stay relevant and continue doing core mission work. In his analysis of well over 2,500 larger nonprofits, York has found that many are not sustaining, and are actually scaling back in size. “One of the biggest challenges of nonprofit sustainability is the general public’s perception that every dollar donated has to go only to the delivery of service,” says York. “What our data shows is that there are some fundamental capacities that have to be there in order for organizations to sustain and grow.” York’s research highlights the importance of data-driven leadership at successful nonprofits. “You’ve got to have the tools, the systems, and the technologies to get objective information on what you do, the people you serve, and the results you’re achieving,” says York. “If leaders don’t have the knowledge and the data, they can’t make the strategic decisions about programs to take organizations to the next level.” Historically, AmeriCares associates have used time-tested and cost-effective strategies to ship and then track supplies from donation to delivery to their destinations in designated time frames. When disaster strikes, AmeriCares ships by air and generally pulls out all the stops to deliver the most urgently needed aid within the first few days and weeks. Then, as situations stabilize, AmeriCares turns to delivering sea containers for the postemergency and ongoing aid so often needed over the long term. According to McDermott, getting a shipment out the door is fairly complicated, requiring as many as five different AmeriCares teams collaborating together. The entire process can take months—from when products are received in the warehouse and deciding which recipients to allocate supplies to, to getting customs and governmental approvals in place, actually shipping products, and finally ensuring that the products are received in-country. Delivering that aid is no small affair. “Our volume exceeds half a billion dollars a year worth of donated medicines and medical supplies, so it’s a sizable logistical operation to bring these products in and get them out to the right place quickly to have the most impact,” says Sears. “We really pride ourselves on our controls and efficiencies.” Adding to that complexity is the fact that the longer it takes to deliver aid, the more dire the human need can be. Any time AmeriCares associates can shave off the complicated aid delivery process can translate into lives saved. “It’s really being able to track information consistently that will help us to see where are the bottlenecks and where can we work on improving our processes,” says McDermott. Setting a Standard Productivity and information management improvements were key objectives for AmeriCares when staff began the process of implementing Oracle’s Primavera solution. But before configuring the software, the staff needed to take the time to analyze the systems already in place. According to Greg Loop, manager of database systems at AmeriCares, the organization received guidance from several consultants, including Rich D’Addario, consulting project manager in the Primavera Global Business Unit at Oracle, who was instrumental in shepherding the critical requirements-gathering phase. D’Addario encouraged staff to begin documenting shipping processes by considering the order in which activities occur and which ones are dependent on others to get accomplished. This exercise helped everyone realize that to be more efficient, they needed to keep track of shipments in a more standard way. “The staff didn’t recognize formal project management methodology,” says D’Addario. “But they did understand what the most important things are and that if they go wrong, an entire project can go off course.” Before, if a boatload of supplies was being sent to Haiti and there was a problem somewhere, a lot of time was taken up finding out where the problem was—because staff was not tracking things in a standard way. As a result, even more time was needed to find possible solutions to the problem and alert recipients that the aid might be delayed. “For everyone to put on the project manager hat and standardize the way every single thing is done means that now the whole organization is on the same page as to what needs to occur from the time a hurricane hits Haiti and when a boat pulls in to unload supplies,” says D’Addario. With so much care taken to put a process foundation firmly in place, configuring the Primavera solution was actually quite simple. Specific templates were set up for different types of shipments, and dashboards were implemented to provide executives with clear overviews of every project in the system. AmeriCares’ Loop reports that system planning, refining, and testing, followed by writing up documentation and training, took approximately four months. The system went live in spring 2011 at AmeriCares’ Connecticut headquarters. While the nonprofit has an international presence, with warehouses in Europe and offices in Haiti, India, Japan, and Sri Lanka, most donated medicines come from U.S. entities and are shipped from the U.S. out to the rest of the world. In addition, all shipments are tracked from the U.S. office. AmeriCares doesn’t expect the Primavera system to take months off the shipping time, especially for sea containers. However, any time saved is still important because it will allow aid to be delivered to people more quickly at a lower overall cost. “If we can trim a day or two here or there, that can translate into lives that we’re saving, especially in emergency situations,” says Sears. A Cultural Change Beyond the measurable benefits that come with IT-driven process improvement, AmeriCares management is seeing a change in culture as a result of the Primavera project. One change has been treating every shipment of aid as a project, and everyone involved with facilitating shipments as a project manager. “This is a revolutionary concept for us,” says McDermott. “Before, we were used to thinking we were doing logistics—getting a container from point A to point B without looking at it as one project and really understanding what it meant to manage it.” AmeriCares staff is also happy to report that collaboration within the organization is much more efficient. When someone creates a shipment in the Primavera system, the same shared template is used, which means anyone can log in to the system to see the status of a shipment. Knowledgeable staff can access a shipment project to help troubleshoot a problem. Management can easily check the status of projects across the organization. “Dashboards are really useful,” says McDermott. “Instead of going into the details of each project, you can just see the high-level real-time information at a glance.” The new system is helping team members focus on proactively managing shipments rather than simply reacting when problems occur. For example, when a container is shipped, documents must be included for customs clearance. Now, the shipping template has built-in reminders to prompt team members to ask for copies of these documents from freight forwarders and to follow up with partners to discover if a shipment is on time. In the past, staff may not have worked on securing these documents until they’d been notified a shipment had arrived in-country. Another benefit of capturing and adopting best practices within the Primavera system is that staff training is easier. “Capturing the processes in documented steps and milestones allows us to teach new staff members how to do their jobs faster,” says Sears. “It provides them with the knowledge of their predecessors so they don’t have to keep reinventing the wheel.” With the Primavera system already generating positive results, management is eager to take advantage of advanced capabilities. Loop is working on integrating the company’s proprietary inventory management system with the Primavera system so that when logistics or warehousing operators input data, the information will automatically go into the Primavera system. In the past, this information had to be manually keyed into spreadsheets, often leading to errors. Mining Historical Data Another feature on the horizon for AmeriCares is utilizing Primavera P6 Professional Project Management reporting capabilities. As the system begins to include more historical data, management soon will be able to draw on this information to conduct analysis that has not been possible before and create customized reports. For example, at the beginning of the shipment process, staff will be able to use historical data to more accurately estimate how long the approval process should take for a particular country. This could help ensure that food and medicine with limited shelf lives do not get stuck in customs or used beyond their expiration dates. The historical data in the Primavera system will also help AmeriCares with better planning year to year. The nonprofit’s staff has always put together a plan at the beginning of the year, but this has been very challenging simply because it is impossible to predict disasters. Now, management will be able to look at historical data and see trends and statistics as they set current objectives and prepare for future need. In addition, this historical data will provide AmeriCares management with the ability to review year-end data and compare actual project results with goals set at the beginning of the year—to see if desired outcomes were achieved and if there are areas that need improvement. It’s this type of information that is so valuable to donors. And, according to York, project management software can play a critical role in generating the data to help nonprofits sustain and grow. “It is important to invest in systems to help replicate, expand, and deliver services,” says York. “Project management software can help because it encourages nonprofits to examine program or service changes and how to manage moving forward.” Sears believes that AmeriCares donors will support the return on investment the organization will achieve with the Primavera solution. “It won’t be financial returns, but rather how many more people we can help for a given dollar or how much more quickly we can respond to a need,” says Sears. “I think donors are receptive to such arguments.” And for AmeriCares, it is all about the future and increasing results. The project management environment currently may be quite simple, but IT staff plans to expand the complexity and functionality as the organization grows in its knowledge of project management and the goals it wants to achieve. “As we use the system over time, we’ll continue to refine our best practices and accumulate more data,” says Sears. “It will advance our ability to make better data-driven decisions.”

    Read the article

  • Oracle OpenWorld 2013 – Wrap up by Sven Bernhardt

    - by JuergenKress
    OOW 2013 is over and we’re heading home, so it is time to lean back and reflecting about the impressions we have from the conference. First of all: OOW was great! It was a pleasure to be a part of it. As already mentioned in our last blog article: It was the biggest OOW ever. Parallel to the conference the America’s Cup took place in San Francisco and the Oracle Team America won. Amazing job by the team and again congratulations from our side Back to the conference. The main topics for us are: Oracle SOA / BPM Suite 12c Adaptive Case management (ACM) Big Data Fast Data Cloud Mobile Below we will go a little more into detail, what are the key takeaways regarding the mentioned points: Oracle SOA / BPM Suite 12c During the five days at OOW, first details of the upcoming major release of Oracle SOA Suite 12c and Oracle BPM Suite 12c have been introduced. Some new key features are: Managed File Transfer (MFT) for transferring big files from a source to a target location Enhanced REST support by introducing a new REST binding Introduction of a generic cloud adapter, which can be used to connect to different cloud providers, like Salesforce Enhanced analytics with BAM, which has been totally reengineered (BAM Console now also runs in Firefox!) Introduction of templates (OSB pipelines, component templates, BPEL activities templates) EM as a single monitoring console OSB design-time integration into JDeveloper (Really great!) Enterprise modeling capabilities in BPM Composer These are only a few points from what is coming with 12c. We are really looking forward for the new realese to come out, because this seems to be really great stuff. The suite becomes more and more integrated. From 10g to 11g it was an evolution in terms of developing SOA-based applications. With 12c, Oracle continues it’s way – very impressive. Adaptive Case Management Another fantastic topic was Adaptive Case Management (ACM). The Oracle PMs did a great job especially at the demo grounds in showing the upcoming Case Management UI (will be available in 11g with the next BPM Suite MLR Patch), the roadmap and the differences between traditional business process modeling. They have been very busy during the conference because a lot of partners and customers have been interested Big Data Big Data is one of the current hype themes. Because of huge data amounts from different internal or external sources, the handling of these data becomes more and more challenging. Companies have a need for analyzing the data to optimize their business. The challenge is here: the amount of data is growing daily! To store and analyze the data efficiently, it is necessary to have a scalable and flexible infrastructure. Here it is important that hardware and software are engineered to work together. Therefore several new features of the Oracle Database 12c, like the new in-memory option, have been presented by Larry Ellison himself. From a hardware side new server machines like Fujitsu M10 or new processors, such as Oracle’s new M6-32 have been announced. The performance improvements, when using one of these hardware components in connection with the improved software solutions were really impressive. For more details about this, please take look at our previous blog post. Regarding Big Data, Oracle also introduced their Big Data architecture, which consists of: Oracle Big Data Appliance that is preconfigured with Hadoop Oracle Exdata which stores a huge amount of data efficently, to achieve optimal query performance Oracle Exalytics as a fast and scalable Business analytics system Analysis of the stored data can be performed using SQL, by streaming the data directly from Hadoop to an Oracle Database 12c. Alternatively the analysis can be directly implemented in Hadoop using “R”. In addition Oracle BI Tools can be used to analyze the data. Fast Data Fast Data is a complementary approach to Big Data. A huge amount of mostly unstructured data comes in via different channels with a high frequency. The analysis of these data streams is also important for companies, because the incoming data has to be analyzed regarding business-relevant patterns in real-time. Therefore these patterns must be identified efficiently and performant. To do so, in-memory grid solutions in combination with Oracle Coherence and Oracle Event Processing demonstrated very impressive how efficient real-time data processing can be. One example for Fast Data solutions that was shown during the OOW was the analysis of twitter streams regarding customer satisfaction. The feeds with negative words like “bad” or “worse” have been filtered and after a defined treshold has been reached in a certain timeframe, a business event was triggered. Cloud Another key trend in the IT market is of course Cloud Computing and what it means for companies and their businesses. Oracle announced their Cloud strategy and vision – companies can focus on their real business while all of the applications are available via Cloud. This also includes Oracle Database or Oracle Weblogic, so that companies can also build, deploy and run their own applications within the cloud. Three different approaches have been introduced: Infrastructure as a Service (IaaS) Platform as a Service (PaaS) Software as a Service (SaaS) Using the IaaS approach only the infrastructure components will be managed in the Cloud. Customers will be very flexible regarding memory, storage or number of CPUs because those parameters can be adjusted elastically. The PaaS approach means that besides the infrastructure also the platforms (such as databases or application servers) necessary for running applications will be provided within the Cloud. Here customers can also decide, if installation and management of these infrastructure components should be done by Oracle. The SaaS approach describes the most complete one, hence all applications a company uses are managed in the Cloud. Oracle is planning to provide all of their applications, like ERP systems or HR applications, as Cloud services. In conclusion this seems to be a very forward-thinking strategy, which opens up new possibilities for customers to manage their infrastructure and applications in a flexible, scalable and future-oriented manner. As you can see, our OOW days have been very very interresting. We collected many helpful informations for our projects. The new innovations presented at the confernce are great and being part of this was even greater! We are looking forward to next years’ conference! Links: http://www.oracle.com/openworld/index.html http://thecattlecrew.wordpress.com/2013/09/23/first-impressions-from-oracle-open-world-2013 SOA & BPM Partner Community For regular information on Oracle SOA Suite become a member in the SOA & BPM Partner Community for registration please visit www.oracle.com/goto/emea/soa (OPN account required) If you need support with your account please contact the Oracle Partner Business Center. Blog Twitter LinkedIn Facebook Wiki Mix Forum Technorati Tags: cattleCrew,Sven Bernhard,OOW2013,SOA Community,Oracle SOA,Oracle BPM,Community,OPN,Jürgen Kress

    Read the article

  • Create and Backup Multiple Profiles in Google Chrome

    - by Asian Angel
    Other browsers such as Firefox and SeaMonkey allow you to have multiple profiles but not Chrome…at least not until now. If you want to use multiple profiles and create backups for them then join us as we look at Google Chrome Backup. Note: There is a paid version of this program available but we used the free version for our article. Google Chrome Backup in Action During the installation process you will run across this particular window. It will have a default user name filled in as shown here…you will not need to do anything except click on Next to continue installing the program. When you start the program for the first time this is what you will see. Your default Chrome Profile will already be visible in the window. A quick look at the Profile Menu… In the Tools Menu you can go ahead and disable the Start program at Windows Startup setting…the only time that you will need the program running is if you are creating or restoring a profile. When you create a new profile the process will start with this window. You can access an Advanced Options mode if desired but most likely you will not need it. Here is a look at the Advanced Options mode. It is mainly focused on adding Switches to the new Chrome Shortcut. The drop-down menu for the Switches available… To create your new profile you will need to choose: A profile location A profile name (as you type/create the profile name it will automatically be added to the Profile Path) Make certain that the Create a new shortcut to access new profile option is checked For our example we decided to try out the Disable plugins switch option… Click OK to create the new profile. Once you have created your new profile, you will find a new shortcut on the Desktop. Notice that the shortcut’s name will be Google Chrome + profile name that you chose. Note: On our system we were able to move the new shortcut to the “Start Menu” without problems. Clicking on our new profile’s shortcut opened up a fresh and clean looking instance of Chrome. Just out of curiosity we did decide to check the shortcut to see if the Switch set up correctly. Unfortunately it did not in this instance…so your mileage with the Switches may vary. This was just a minor quirk and nothing to get excited or upset over…especially considering that you can create multiple profiles so easily. After opening up our default profile of Chrome you can see the individual profile icons (New & Default in order) sitting in the Taskbar side-by-side. And our two profiles open at the same time on our Desktop… Backing Profiles Up For the next part of our tests we decided to create a backup for each of our profiles. Starting the wizard will allow you to choose between creating or restoring a profile. Note: To create or restore a backup click on Run Wizard. When you reach the second part of the process you can go with the Backup default profile option or choose a particular one from a drop-down list using the Select a profile to backup option. We chose to backup the Default Profile first… In the third part of the process you will need to select a location to save the profile to. Once you have selected the location you will see the Target Path as shown here. You can choose your own name for the backup file…we decided to go with the default name instead since it contained the backup’s calendar date. A very nice feature is the ability to have the cache cleared before creating the backup. We clicked on Yes…choose the option that best suits your needs. Once you have chosen either Yes or No the backup will then be created. Click Finish to complete the process. The backup file for our Default Profile at 14.0 MB in size. And the backup file for our Chrome Fresh Profile…2.81 MB. Restoring Profiles For the final part of our tests we decided to do a Restore. Select Restore and click Next to get the process started. In the second step you will need to browse for the Profile Backup File (and select the desired profile if you have created multiples). For our example we decided to overwrite the original Default Profile with the Chrome Fresh Profile. The third step lets you choose where to restore the chosen profile to…you can go with the Default Profile or choose one from the drop-down list using the Restore to a selected profile option. The final step will get you on your way to restoring the chosen profile. The program will conduct a check regarding the previous/old profile and ask if you would like to proceed with overwriting it. Definitely nice in case you change your mind at the last moment. Clicking Yes will finish the restoration. The only other odd quirk that we noticed while using the program was that the Next Button did not function after restoring the profile. You can easily get around the problem by clicking to close the window. Which one is which? After the restore process we had identical twins. Conclusion If you have been looking for a way to create multiple profiles in Google Chrome, then you might want to add this program to your system. Links Download Google Chrome Backup Similar Articles Productive Geek Tips Backup and Restore Firefox Profiles EasilyBackup Different Browsers Easily with FavBackupBackup Your Browser with the New FavBackupStupid Geek Tricks: Compare Your Browser’s Memory Usage with Google ChromeHow to Make Google Chrome Your Default Browser TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips Acronis Online Backup DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows Tech Fanboys Field Guide Check these Awesome Chrome Add-ons iFixit Offers Gadget Repair Manuals Online Vista style sidebar for Windows 7 Create Nice Charts With These Web Based Tools Track Daily Goals With 42Goals

    Read the article

  • Communities - The importance of exchange and discussion

    Communication with your environment is an essential part of everyone's life. And it doesn't matter whether you are actually living in a rural area in the middle of nowhere, within the pulsating heart of a big city, or in my case on a wonderful island in the Indian Ocean. The ability to exchange your thoughts, your experience and your worries with another person helps you to get different points of view and new ideas on how to resolve an issue you might be confronted with. Benefits of community work What happens to be common sense in your daily life, also applies to your work environment. Working in IT, or ICT as it is called in Mauritius, requires a lot of reading and learning. Not only during your lectures at the university but with your colleagues in a project assignment and hopefully with 'unknown' pals in the universe of online communities. At least I can say that I learned quite a lot from other developers code, their responses in various forums, their numerous blog articles, and while attending local user group meetings. When I started to work as a professional software developer (or engineer some may say) years ago I immediately checked the existence of communities on the programming language, the database technology and other vital information on software development in general. Luckily, it wasn't too difficult to find. My employer had a subscription of the monthly magazines and newsletters of a national organisation which also run the biggest forum in that area. Getting in touch with other developers and reading their common problems but also solutions was a huge benefit to my growth. Image courtesy of Michael Kappel (CC BY-NC 2.0) Active participation and regular contribution to this community gave me some nice advantages, too. Within three years I was listed as a conference speaker at the annual developer's conference and provided several sessions on different topics during consecutive years. Back in 2004, I took over the responsibility and management of the monthly meetings of a regional user group, and organised it for more than two years. Furthermore, I was invited to the newly-founded community program of Microsoft Germany (Community Leader/Insider Program - CLIP). My website on Active FoxPro Pages was nominated in the second batch of online communities. Due to my community work and providing advice to others, I had the honour to be awarded as Microsoft Most Valuable Professional (MVP) - Visual Developer for Visual FoxPro in the years 2006 and 2007. It was a great experience to meet with other like-minded people and I'm really grateful for that. Just in case, more details are listed in my Curriculum Vitae. But this all changed when I moved to Mauritius... Cyber island Mauritius? During the first months in Mauritius I was way too busy to think about community activities at all. First of all, there was the new company that had to be set up, the new staff had to be trained and of course the communication work-flows and so on with the project managers back in Germany had to be sorted out, too. Second, I had to get a grip of my private matters like getting the basics for my new household or exploring the neighbourhood, and last but not least I needed a break from the hectic and intensive work prior to my departure. As soon as the sea literally calmed down, I started to have conversations with my colleagues about communities and user groups. Sadly, it turned out that there were none, or at least no one was aware of any at that time. Oh oh, what did I do? Anyway, having this kind of background and very positive experience with off-line and on-line activities I decided for myself that some day I'm going to found a community in Mauritius for all kind of IT/ICT-related fields. The main focus might be on software development but not on a certain technology or methodology. It was clear to me that it should be an open infrastructure and anyone is welcome to join, to experience, to share and to contribute if they would like to. That was the idea at that time... Ok, fast-forward to recent events. At the end of October 2012 I was invited to an event called Open Days organised by Microsoft Indian Ocean Islands together with other local partners and resellers. There I got in touch with local Technical Evangelist Arnaud Meslier and we had a good conversation on communities during the breaks. Eventually, I left a good impression on him, as we are having chats on Facebook or Skype irregularly. Well, seeing that my personal and professional surroundings have been settled and running smooth, having that great exchange and contact with Microsoft IOI (again), and being really eager to re-animate my intentions from 2007, I recently founded a new community: Mauritius Software Craftsmanship Community - #MSCC It took me a while to settle down with the name but it was obvious that the community should not be attached to one single technology, like ie. .NET user group, Oracle developers, or Joomla friends (these are fictitious names). There are several other reasons why I came up with 'Craftsmanship' as the core topic of this community. The expression of 'engineering' didn't feel right with the fields covered. Software development in all kind of facets is a craft, and therefore demands a lot of practice but also guidance from more experienced developers. It also includes the process of designing, modelling and drafting the ideas. Has to deal with various types of tests and test methodologies, and of course should be focused on flexible and agile ways of acting. In order to meet and to excel a customer's request for a solution. Next, I was looking for an easy way to handle the organisation of events and meeting appointments. Using all kind of social media platforms like Google+, LinkedIn, Facebook, Xing, etc. I was never really confident about their features of event handling. More by chance I stumbled upon Meetup.com and in combination with the other entities (G+ Communities, FB Pages or in Groups) I am looking forward to advertise and manage all future activities here: Mauritius Software Craftsmanship Community This is a community for those who care and are proud of what they do. For those developers, regardless how experienced they are, who want to improve and master their craft. This is a community for those who believe that being average is just not good enough. I know, there are not many 'craftsmen' yet but it's a start... Let's see how it looks like by the end of the year. There are free smartphone apps for Android and iOS from Meetup.com that allow you to keep track of meetings and to stay informed on latest updates. And last but not least, there will be a Trello workspace to collect and share ideas and provide downloads of slides, etc. Sharing is caring! As mentioned, the #MSCC is present in various social media networks in order to cover as many people as possible here in Mauritius. Following is an overview of the current networks: Twitter - Latest updates and quickies Google+ - Community channel Facebook - Community Page LinkedIn - Community Group Trello - Collaboration workspace to share and develop ideas Hopefully, this covers the majority of computer-related people in Mauritius. Please spread the word about the #MSCC between your colleagues, your friends and other interested 'geeks'. Your future looks bright Running and participating in a user group or any kind of community usually provides quite a number of advantages for anyone. On the one side it is very joyful for me to organise appointments and get in touch with people that might be interested to present a little demo of their projects or their recent problems they had to tackle down, and on the other side there are lots of companies that have various support programs or sponsorships especially tailored for user groups. At the moment, I already have a couple of gimmicks that I would like to hand out in small contests or raffles during one of the upcoming meetings, and as said, companies provide all kind of goodies, books free of charge, or sometimes even licenses for communities. Meeting other software developers or IT guys also opens up your point of view on the local market and there might be interesting projects or job offers available, too. A community like the Mauritius Software Craftsmanship Community is great for freelancers, self-employed, students and of course employees. Meetings will be organised on a regular basis, and I'm open to all kind of suggestions from you. Please leave a comment here in blog or join the conversations in the above mentioned social networks. Let's get this community up and running, my fellow Mauritians!

    Read the article

  • Day 3 - XNA: Hacking around with images

    - by dapostolov
    Yay! Today I'm going to get into some code! My mind has been on this all day! I find it amusing how I practice, daily, to be "in the moment" or "present" and the excitement and anticipation of this project seems to snatch it away from me frequently. WELL!!! (Shakes Excitedly) Let's do this =)! Let's code! For these next few days it is my intention to better understand image rendering using XNA; after said prototypes are complete I should (fingers crossed) be able to dive into my game code using the design document I hammered out the other night. On a personal note, I think the toughest thing right now is finding the time to do this project. Each night, after my little ones go to bed I can only really afford a couple hours of work on this project. However, I hope to utilise this time as best as I can because this is the first time in a while I've found a project that I've been passionate about. A friend recently asked me if I intend to go 3D or extend the game design. Yes. For now I'm keeping it simple. Lastly, just as a note, as I was doing some further research into image rendering this morning I came across some other XNA content and lessons learned. I believe this content could have probably been posted in the first couple of posts, however, I will share the new content as I learn it at the end of each day. Maybe I'll take some time later to fix the posts but for now Installation and Deployment - Lessons Learned I had installed the XNA studio  (Day 1) and the site instructions were pretty easy to follow. However, I had a small difficulty with my development environment. You see, I run a virtual desktop development environment. Even though I was able to code and compile all the tutorials the game failed to run...because I lacked a 3D capable card; it was not detected on the virtual box... First Lesson: The XNA runtime needs to "see" the 3D card! No sweat, Il copied the files over to my parent box and executed the program. ERROR. Hmm... Second Lesson (which I should have probably known but I let the excitement get the better of me): you need the XNA runtime on the client PC to run the game, oh, and don't forget the .Net Runtime! Sprite, it ain't just a Soft Drink... With these prototypes I intend to understand and perform the following tasks. learn game development terminology how to place and position (rotate) a static image on the screen how to layer static images on the screen understand image scaling can we reuse images? understand how framerate is handled in XNA how to display text , basic shapes, and colors on the screen how to interact with an image (collision of user input?) how to animate an image and understand basic animation techniques how to detect colliding images or screen edges how to manipulate the image, lets say colors, stretching how to focus on a segment of an image...like only displaying a frame on a film reel what's the best way to manage images (compression, storage, location, prevent artwork theft, etc.) Well, let's start with this "prototype" task list for now...Today, let's get an image on the screen and maybe I can mark a few of the tasks as completed... C# Prototype1 New Visual Studio Project Select the XNA Game Studio 3.1 Project Type Select the Windows Game 3.1 Template Type Prototype1 in the Name textbox provided Press OK. At this point code has auto-magically been created. Feel free to press the F5 key to run your first XNA program. You should have a blue screen infront of you. Without getting into the nitty gritty right, the code that was generated basically creates some basic code to clear the window content with the lovely CornFlowerBlue color. Something to notice, when you move your mouse into the window...nothing. ooooo spoooky. Let's put an image on that screen! Step A - Get an Image into the solution Under "Content" in your Solution Explorer, right click and add a new folder and name it "Sprites". Copy a small image in there; I copied a "Royalty Free" wizard hat from a quick google search and named it wizards_hat.jpg (rightfully so!) Step B - Add the sprite and position fields Now, open/edit  Game1.cs Locate the following line:  SpriteBatch spriteBatch; Under this line type the following:         SpriteBatch spriteBatch; // the line you are looking for...         Texture2D sprite;         Vector2 position; Step C - Load the image asset Locate the "Load Content" Method and duplicate the following:             protected override void LoadContent()         {             spriteBatch = new SpriteBatch(GraphicsDevice);             // your image name goes here...             sprite = Content.Load<Texture2D>("Sprites\\wizards_hat");             position = new Vector2(200, 100);             base.LoadContent();         } Step D - Draw the image Locate the "Draw" Method and duplicate the following:        protected override void Draw(GameTime gameTime)         {             GraphicsDevice.Clear(Color.CornflowerBlue);             spriteBatch.Begin(SpriteBlendMode.AlphaBlend);             spriteBatch.Draw(sprite, position, Color.White);             spriteBatch.End();             base.Draw(gameTime);         }  Step E - Compile and Run Engage! (F5) - Debug! Your image should now display on a cornflowerblue window about 200 pixels from the left and 100 pixels from the top. Awesome! =) Pretty cool how we only coded a few lines to display an image, but believe me, there is plenty going on behind the scenes. However, for now, I'm going to call it a night here. Blogging all this progress certainly takes time... However, tomorrow night I'm going to detail what we just did, plus start checking off points on that list! I'm wondering right now if I should add pictures / code to this post...let me know if you want them =) Best Regards, D.

    Read the article

  • Building an Infrastructure Cloud with Oracle VM for x86 + Enterprise Manager 12c

    - by Richard Rotter
    Cloud Computing? Everyone is talking about Cloud these days. Everyone is explaining how the cloud will help you to bring your service up and running very fast, secure and with little effort. You can find these kinds of presentations at almost every event around the globe. But what is really behind all this stuff? Is it really so simple? And the answer is: Yes it is! With the Oracle SW Stack it is! In this post, I will try to bring this down to earth, demonstrating how easy it could be to build a cloud infrastructure with Oracle's solution for cloud computing.But let me cover some basics first: How fast can you build a cloud?How elastic is your cloud so you can provide new services on demand? How much effort does it take to monitor and operate your Cloud Infrastructure in order to meet your SLAs?How easy is it to chargeback for your services provided? These are the critical success factors of Cloud Computing. And Oracle has an answer to all those questions. By using Oracle VM for X86 in combination with Enterprise Manager 12c you can build and control your cloud environment very fast and easy. What are the fundamental building blocks for your cloud? Oracle Cloud Building Blocks #1 Hardware Surprise, surprise. Even the cloud needs to run somewhere, hence you will need hardware. This HW normally consists of servers, storage and networking. But Oracles goes beyond that. There are Optimized Solutions available for your cloud infrastructure. This is a cookbook to build your HW cloud platform. For example, building your cloud infrastructure with blades and our network infrastructure will reduce complexity in your datacenter (Blades with switch network modules, splitter cables to reduce the amount of cables, TOR (Top Of the Rack) switches which are building the interface to your infrastructure environment. Reducing complexity even in the cabling will help you to manage your environment more efficient and with less risk. Of course, our engineered systems fit into the cloud perfectly too. Although they are considered as a PaaS themselves, having the database SW (for Exadata) and the application development environment (for Exalogic) already deployed on them, in general they are ideal systems to enable you building your own cloud and PaaS infrastructure. #2 Virtualization The next missing link in the cloud setup is virtualization. For me personally, it's one of the most hidden "secret", that oracle can provide you with a complete virtualization stack in terms of a hypervisor on both architectures: X86 and Sparc CPUs. There is Oracle VM for X86 and Oracle VM for Sparc available at no additional  license costs if your are running this virtualization stack on top of Oracle HW (and with Oracle Premier Support for HW). This completes the virtualization portfolio together with Solaris Zones introduced already with Solaris 10 a few years ago. Let me explain how Oracle VM for X86 works: Oracle VM for x86 consists of two main parts: - The Oracle VM Server: Oracle VM Server is installed on bare metal and it is the hypervisor which is able to run virtual machines. It has a very small footprint. The ISO-Image of Oracle VM Server is only 200MB large. It is very small but efficient. You can install a OVM-Server in less than 5 mins by booting the Server with the ISO-Image assigned and providing the necessary configuration parameters (like installing an Linux distribution). After the installation, the OVM-Server is ready to use. That's all. - The Oracle VM-Manager: OVM-Manager is the central management tool where you can control your OVM-Servers. OVM-Manager provides the graphical user interface, which is an Application Development Framework (ADF) application, with a familiar web-browser based interface, to manage Oracle VM Servers, virtual machines, and resources. The Oracle VM Manager has the following capabilities: Create virtual machines Create server pools Power on and off virtual machines Manage networks and storage Import virtual machines, ISO files, and templates Manage high availability of Oracle VM Servers, server pools, and virtual machines Perform live migration of virtual machines I want to highlight one of the goodies which you can use if you are running Oracle VM for X86: Preconfigured, downloadable Virtual Machine Templates form edelivery With these templates, you can download completely preconfigured Virtual Machines in your environment, boot them up, configure them at first time boot and use it. There are templates for almost all Oracle SW and Applications (like Fusion Middleware, Database, Siebel, etc.) available. #3) Cloud Management The management of your cloud infrastructure is key. This is a day-to-day job. Acquiring HW, installing a virtualization layer on top of it is done just at the beginning and if you want to expand your infrastructure. But managing your cloud, keeping it up and running, deploying new services, changing your chargeback model, etc, these are the daily jobs. These jobs must be simple, secure and easy to manage. The Enterprise Manager 12c Cloud provides this functionality from one management cockpit. Enterprise Manager 12c uses Oracle VM Manager to control OVM Serverpools. Once you registered your OVM-Managers in Enterprise Manager, then you are able to setup your cloud infrastructure and manage everything from Enterprise Manager. What you need to do in EM12c is: ">Register your OVM Manager in Enterprise ManagerAfter Registering your OVM Manager, all the functionality of Oracle VM for X86 is also available in Enterprise Manager. Enterprise Manager works as a "Manger" of the Manager. You can register as many OVM-Managers you want and control your complete virtualization environment Create Roles and Users for your Self Service Portal in Enterprise ManagerWith this step you allow users to logon on the Enterprise Manager Self Service Portal. Users can request Virtual Machines in this portal. Setup the Cloud InfrastructureSetup the Quotas for your self service users. How many VMs can they request? How much of your resources ( cpu, memory, storage, network, etc. etc.)? Which SW components (templates, assemblys) can your self service users request? In this step, you basically set up the complete cloud infrastructure. Setup ChargebackOnce your cloud is set up, you need to configure your chargeback mechanism. The Enterprise Manager collects the resources metrics, which are used in a very deep level. Almost all collected Metrics could be used in the chargeback module. You can define chargeback plans based on configurations (charge for the amount of cpu, memory, storage is assigned to a machine, or for a specific OS which is installed) or chargeback on resource consumption (% of cpu used, storage used, etc). Or you can also define a combination of configuration and consumption chargeback plans. The chargeback module is very flexible. Here is a overview of the workflow how to handle infrastructure cloud in EM: Summary As you can see, setting up an Infrastructure Cloud Service with Oracle VM for X86 and Enterprise Manager 12c is really simple. I personally configured a complete cloud environment with three X86 servers and a small JBOD san box in less than 3 hours. There is no magic in it, it is all straightforward. Of course, you have to have some experience with Oracle VM and Enterprise Manager. Experience in setting up Linux environments helps as well. I plan to publish a technical cookbook in the next few weeks. I hope you found this post useful and will see you again here on our blog. Any hints, comments are welcome!

    Read the article

  • Moving from Tortoise to TFS

    - by MarkPearl
    The Past A few years ago my small software company made the jump from storing code on a shared folder to source code control. At the time we had evaluated a few of the options and settled on Tortoise SVN. The main motivation for going the SVN route was that we found a great plugin for Visual Studio that allowed us to avoid the command prompt for uploading changes (like I said we are windows programmers… command prompt bad!! ) and it was free. Up to now we have been pretty happy with SVN as it removed many of the worries that I had about how safe my code was on a shared folder and also gave us the opportunity to safely have several developers work on the same project at the same time. The only times when we have been unhappy has been when we have had SVN hell days – which pretty much occur when you are doing something out of the norm and suddenly SVN just won’t resolve conflicts or something along those lines. This happens once every 4 or 5 months and is not necessarily a problem caused directly by SVN – but a problem augmented by SVN. When you have SVN hell days you want to curse SVN! With that in mind I recently have been relooking at our source code control. I have explored using GIT and was very impressed by it and have also looked at TFS. From a source code control perspective I don’t want to get into a heated discussion on which one is better – but I do want to mention that I wear two hats in my organization – software developer & manager, and with the manager hat on I tend to sway the TFS route. So when I was given a coupon to test DiscountASP.Net Team Foundation Server Service for a year, I thought it was the perfect opportunity to try TFS in a distributed environment and also make the first step towards having an integrated development management system. Some of the things that appeal to me about DiscountASP’s offering are the following… Basic management / planning facilities like to do lists inside Visual Studio Daily backup of data on the server – we are developers, not IT managers and so the more of this I could outsource the better Distributed solution – all of us work remotely and so this was a big one as well. Registering and Setting Up with DiscountASP.NET The whole registration process was simple and intuitive. The web interface is not the most visually impressive one, but it is functional and a few seconds after I clicked the last submit button a email was sitting in my inbox giving me my control panel username and suggesting that I read the “Getting Started” article. The getting started article was easy to read and understand so no complaints there either. Next to set my dev environment to work. With a few references to the getting started article I had completed the whole setup process in a matter of minutes. Ten minutes after initiating the whole thing I was logged into VS2010 and creating my first TFS project. With the service that I signed up for, I have access for 5 users – which is sufficient for my internal needs. So from what I can tell, to set the rest of us up on the system I just need to supply them with their user credentials and url. My Concerns Resolved 1) Security So, a few concerns I had about the service. First and foremost – is it secure? I would hate for someone to get access to our code and the whole idea of putting it up on the internet is a concern for me. Turning to the Knowledge Base on the DiscountASP website this is one of the first question I can see answered. According to them it is secure. I have extracted their comment below regarding this. Our TFS hosting service is secure. We only accept HTTPS connections ensuring that any client-server data transmission is encrypted. At the network level, all of our systems are protected by multiple Juniper firewalls, Tipping Point's Intrusion Detection System (see Tipping Point's case study of our use here), and we also employ DDoS mitigation to add extra layers of security. Additionally, physical access to the servers is tightly restricted. Please see the security section of this Knowledge Base article for further details. 2) Web Portal Access The other big concern I have is regarding web portal access. In the ideal world I would like to be able to give my end users access to a web portal for reporting bugs etc. When I initially read through the FAQ of the site it mentioned that there was web portal access – but from what I can see this is just for “users”. Since I am limited to 5 users for the account, it would not be practical to set up external users that we could get feedback from on bugs etc. I would be interested if this is possible – and if so if someone could post it in the comments it would be much appreciated. If this isn’t possible, it is a slight let down as we rely heavily on end user feedback to get feedback and it would have been ideal to have gotten this within the service. Other than those two items, I didn’t have any real concerns that were unresolved. So where do I go from here? So time passed by from the initial writing of this post and as work whirred in and out of my inbox I have still not had a proper opportunity to give the service a test run. Recently though things have began to slow down and then surprise surprise I had another SVN Hell day. With that experience I had a new found resolve to get our team on TFS and so today we are going to start to use the service as a team. I am hoping that I do not have TFS hell days – but if I do, I will be sure to write about them. In short - the verdict is still out on whether this service is going to be invaluable to my business or whether it will create more headaches than it is worth BUT I am hopping it will be an invaluable service. I will only really be able to determine that in a few months… till then!

    Read the article

  • DBA Best Practices - A Blog Series: Episode 1 - Backups

    - by Argenis
      This blog post is part of the DBA Best Practices series, on which various topics of concern for daily database operations are discussed. Your feedback and comments are very much welcome, so please drop by the comments section and be sure to leave your thoughts on the subject. Morning Coffee When I was a DBA, the first thing I did when I sat down at my desk at work was checking that all backups had completed successfully. It really was more of a ritual, since I had a dual system in place to check for backup completion: 1) the scheduled agent jobs to back up the databases were set to alert the NOC in failure, and 2) I had a script run from a central server every so often to check for any backup failures. Why the redundancy, you might ask. Well, for one I was once bitten by the fact that database mail doesn't work 100% of the time. Potential causes for failure include issues on the SMTP box that relays your server email, firewall problems, DNS issues, etc. And so to be sure that my backups completed fine, I needed to rely on a mechanism other than having the servers do the taking - I needed to interrogate the servers and ask each one if an issue had occurred. This is why I had a script run every so often. Some of you might have monitoring tools in place like Microsoft System Center Operations Manager (SCOM) or similar 3rd party products that would track all these things for you. But at that moment, we had no resort but to write our own Powershell scripts to do it. Now it goes without saying that if you don't have backups in place, you might as well find another career. Your most sacred job as a DBA is to protect the data from a disaster, and only properly safeguarded backups can offer you peace of mind here. "But, we have a cluster...we don't need backups" Sadly I've heard this line more than I would have liked to. You need to understand that a cluster is comprised of shared storage, and that is precisely your single point of failure. A cluster will protect you from an issue at the Operating System level, and also under an outage of any SQL-related service or dependent devices. But it will most definitely NOT protect you against corruption, nor will it protect you against somebody deleting data from a table - accidentally or otherwise. Backup, fine. How often do I take a backup? The answer to this is something you will hear frequently when working with databases: it depends. What does it depend on? For one, you need to understand how much data your business is willing to lose. This is what's called Recovery Point Objective, or RPO. If you don't know how much data your business is willing to lose, you need to have an honest and realistic conversation about data loss expectations with your customers, internal or external. From my experience, their first answer to the question "how much data loss can you withstand?" will be "zero". In that case, you will need to explain how zero data loss is very difficult and very costly to achieve, even in today's computing environments. Do you want to go ahead and take full backups of all your databases every hour, or even every day? Probably not, because of the impact that taking a full backup can have on a system. That's what differential and transaction log backups are for. Have I answered the question of how often to take a backup? No, and I did that on purpose. You need to think about how much time you have to recover from any event that requires you to restore your databases. This is what's called Recovery Time Objective. Again, if you go ask your customer how long of an outage they can withstand, at first you will get a completely unrealistic number - and that will be your starting point for discussing a solution that is cost effective. The point that I'm trying to get across is that you need to have a plan. This plan needs to be practiced, and tested. Like a football playbook, you need to rehearse the moves you'll perform when the time comes. How often is up to you, and the objective is that you feel better about yourself and the steps you need to follow when emergency strikes. A backup is nothing more than an untested restore Backups are files. Files are prone to corruption. Put those two together and realize how you feel about those backups sitting on that network drive. When was the last time you restored any of those? Restoring your backups on another box - that, by the way, doesn't have to match the specs of your production server - will give you two things: 1) peace of mind, because now you know that your backups are good and 2) a place to offload your consistency checks with DBCC CHECKDB or any of the other DBCC commands like CHECKTABLE or CHECKCATALOG. This is a great strategy for VLDBs that cannot withstand the additional load created by the consistency checks. If you choose to offload your consistency checks to another server though, be sure to run DBCC CHECKDB WITH PHYSICALONLY on the production server, and if you're using SQL Server 2008 R2 SP1 CU4 and above, be sure to enable traceflags 2562 and/or 2549, which will speed up the PHYSICALONLY checks further - you can read more about this enhancement here. Back to the "How Often" question for a second. If you have the disk, and the network latency, and the system resources to do so, why not backup the transaction log often? As in, every 5 minutes, or even less than that? There's not much downside to doing it, as you will have to clear the log with a backup sooner than later, lest you risk running out space on your tlog, or even your drive. The one drawback to this approach is that you will have more files to deal with at restore time, and processing each file will add a bit of extra time to the entire process. But it might be worth that time knowing that you minimized the amount of data lost. Again, test your plan to make sure that it matches your particular needs. Where to back up to? Network share? Locally? SAN volume? This is another topic where everybody has a favorite choice. So, I'll stick to mentioning what I like to do and what I consider to be the best practice in this regard. I like to backup to a SAN volume, i.e., a drive that actually lives in the SAN, and can be easily attached to another server in a pinch, saving you valuable time - you wouldn't need to restore files on the network (slow) or pull out drives out a dead server (been there, done that, it’s also slow!). The key is to have a copy of those backup files made quickly, and, if at all possible, to a remote target on a different datacenter - or even the cloud. There are plenty of solutions out there that can help you put such a solution together. That right there is the first step towards a practical Disaster Recovery plan. But there's much more to DR, and that's material for a different blog post in this series.

    Read the article

  • Agilist, Heal Thyself!

    - by Dylan Smith
    I’ve been meaning to blog about a great experience I had earlier in the year at Prairie Dev Con Calgary.  Myself and Steve Rogalsky did a session that we called “Agilist, Heal Thyself!”.  We used a format that was new to me, but that Steve had seen used at another conference.  What we did was start by asking the audience to give us a list of challenges they had had when adopting agile.  We wrote them all down, then had everybody vote on the most interesting ones.  Then we split into two groups, and each group was assigned one of the agile challenges.  We had 20 minutes to discuss the challenge, and suggest solutions or approaches to improve things.  At the end of the 20 minutes, each of the groups gave a brief summary of their discussion and learning's, then we mixed up the groups and repeated with another 2 challenges. The 2 groups I was part of had some really interesting discussions, and suggestions: Unfinished Stories at the end of Sprints The first agile challenge we tackled, was something that every single Scrum team I have worked with has struggled with.  What happens when you get to the end of a Sprint, and there are some stories that are only partially completed.  The team in question was getting very de-moralized as they felt that every Sprint was a failure as they never had a set of fully completed stories. How do you avoid this? and/or what do you do when it happens? There were 2 pieces of advice that were well received: 1. Try to bring stories to completion before starting new ones.  This is advice I give all my Scrum teams.  If you have a 3-week sprint, what happens all too often is you get to the end of week 2, and a lot of stories are almost done; but almost none are completely done.  This is a Bad Thing.  I encourage the teams I work with to only start a new story as a very last resort.  If you finish your task look at the stories in progress and see if there’s anything you can do to help before moving onto a new story.  In the daily standup, put a focus on seeing what stories got completed yesterday, if a few days go by with none getting completed, be sure this fact is visible to the team and do something about it.  Something I’ve been doing recently is introducing WIP (Work In Progress) limits while using Scrum.  My current team has 2-week sprints, and we usually have about a dozen or stories in a sprint.  We instituted a WIP limit of 4 stories.  If 4 stories have been started but not finished then nobody is allowed to start new stories.  This made it obvious very quickly that our QA tasks were our bottleneck (we have 4 devs, but only 1.5 testers).  The WIP limit forced the developers to start to pickup QA tasks before moving onto the next dev tasks, and we ended our sprints with many more stories completely finished than we did before introducing WIP limits. 2. Rather than using time-boxed sprints, why not just do away with them altogether and go to a continuous flow type approach like KanBan.  Limit WIP to keep things under control, but don’t have a fixed time box at the end of which all tasks are supposed to be done.  This eliminates the problem almost entirely.  At some points in the project (releases) you need to be able to burn down all the half finished stories to get a stable release build, but this probably occurs less often than every sprint, and there are alternative approaches to achieve it using branching strategies rather than forcing your team to try to get to Zero WIP every 2-weeks (e.g. when you are ready for a release, create a new branch for any new stories, but finish all existing stories in the current branch and release it). Trying to Introduce Agile into a team with previous Bad Agile Experiences One of the agile adoption challenges somebody described, was he was in a leadership role on a team he had recently joined – lets call him Dave.  This team was currently very waterfall in their ALM process, but they were about to start on a new green-field project.  Dave wanted to use this new project as an opportunity to do things the “right way”, using an Agile methodology like Scrum, adopting TDD, automated builds, proper branching strategies, etc.  The problem he was facing is everybody else on the team had previously gone through an “Agile Adoption” that was a horrible failure.  Dave blamed this failure on the consultant brought in previously to lead this agile transition, but regardless of the reason, the team had very negative feelings towards agile, and was very resistant to trying it out again.  Dave possibly had the authority to try to force the team to adopt Agile practices, but we all know that doesn’t work very well.  What was Dave to do? Ultimately, the best advice was to question *why* did Dave want to adopt all these various practices. Rather than trying to convince his team that these were the “right way” to run a dev project, and trying to do a Big Bang approach to introducing change.  He would be better served by identifying problems the team currently faces, have a discussion with the team to get everybody to agree that specific problems existed, then have an open discussion about ways to address those problems.  This way Dave could incrementally introduce agile practices, and he doesn’t even need to identify them as “agile” practices if he doesn’t want to.  For example, when we discussed with Dave, he said probably the teams biggest problem was long periods without feedback from users, then finding out too late that the software is not going to meet their needs.  Rather than Dave jumping right to introducing Scrum and all it entails, it would be easier to get buy-in from team if he framed it as a discussion of existing problems, and brainstorming possible solutions.  And possibly most importantly, don’t try to do massive changes all at once with a team that has not bought-into those changes.  Taking an incremental approach has a greater chance of success. I see something similar in my day job all the time too.  Clients who for one reason or another claim to not be fans of agile (or not ready for agile yet).  But then they go on to ask me to help them get shorter feedback cycles, quicker delivery cycles, iterative development processes, etc.  It’s kind of funny at times, sometimes you just need to phrase the suggestions in terms they are using and avoid the word “agile”. PS – I haven’t blogged all that much over the past couple of years, but in an attempt to motivate myself, a few of us have accepted a blogger challenge.  There’s 6 of us who have all put some money into a pool, and the agreement is that we each need to blog at least once every 2-weeks.  The first 2-week period that we miss we’re eliminated.  Last person standing gets the money.  So expect at least one blog post every couple of weeks for the near future (I hope!).  And check out the blogs of the other 5 people in this blogger challenge: Steve Rogalsky: http://winnipegagilist.blogspot.ca Aaron Kowall: http://www.geekswithblogs.net/caffeinatedgeek Tyler Doerkson: http://blog.tylerdoerksen.com David Alpert: http://www.spinthemoose.com Dave White: http://www.agileramblings.com (note: site not available yet.  should be shortly or he owes me some money!)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Webcast Q&A: ING on How to Scale Role Management and Compliance

    - by Tanu Sood
    Thanks to all who attended the live webcast we hosted on ING: Scaling Role Management and Access Certifications to Thousands of Applications on Wed, April 11th. Those of you who couldn’t join us, the webcast replay is now available. Many thanks to our guest speaker, Mark Robison, Enterprise Architect at ING for walking us through ING’s drivers and rationale for the platform approach, the phased implementation strategy, results & metrics, roadmap and recommendations. We greatly appreciate the insight he shared with us all on the deployment synergies between Oracle Identity Manager (OIM) and Oracle Identity Analytics (OIA) to enforce streamlined user and role management and scalable compliance. Mark was also kind enough to walk us through specific solutions features that helped ING manage the problem of role explosion and implement closed loop remediation. Our host speaker, Neil Gandhi, Principal Product Manager, Oracle rounded off the presentation by discussing common use cases and deployment scenarios we see organizations implement to automate user/identity administration and enforce closed-loop scalable compliance. Neil also called out the specific features in Oracle Identity Analytics 11gR1 that cater to expediting and streamlining compliance processes such as access certifications. While we tackled a few questions during the webcast, we have captured the responses to those that we weren’t able to get to here; our sincere thanks to Mark Robison for taking the time to respond to questions specific to ING’s implementation and strategy. Q. Did you include business friendly entitlment descriptions, or is the business seeing application descriptors A. We include very business friendly descriptions.  The OIA tool has the facility to allow this. Q. When doing attestation on job change, who is in the workflow to review and confirm that the employee should continue to have access? Is that a best practice?   A. The new and old manager  are in the workflow.  The tool can check for any Separation of Duties (SOD) violations with both having similiar accesses.  It may not be a best practice, but it is a reality of doing your old and new job for a transition period on a transfer. Q. What versions of OIM and OIA are being used at ING?   A. OIM 11gR1 and OIA 11gR1; the very latest versions available. Q. Are you using an entitlements / role catalog?   A. Yes. We use both roles and entitlements. Q. What specific unexpected benefits did the Identity Warehouse provide ING?   A. The most unanticipated was to help Legal Hold identify user ID's in the various applications.   Other benefits included providing a one stop shop for all aggregated ID information. Q. How fine grained are your application and entitlements? Did OIA, OIM support that level of granularity?   A. We have some very fine grained entitlements, but we role this up into approved Roles to allow for easier management.   For managing very fine grained entitlements, Oracle offers the Oracle Entitlement Server.  We currently do not own this software but are considering it. Q. Do you allow any individual access or is everything truly role based?   A. We are a hybrid environment with roles and individual positive and negative entitlements Q. Did you use an Agile methodology like scrum to deliver functionality during your project? A. We started with waterfall, but used an agile approach to provide benefits after the initial implementation Q. How did you handle rolling out the standard ID format to existing users? A. We just used the standard IDs for new users.  We have not taken on a project to address the existing nonstandard IDs. Q. To avoid role explosion, how do you deal with apps that require more than a couple of entitlement TYPES? For example, an app may have different levels of access and it may need to know the user's country/state to associate them with particular customers.   A. We focus on the functional user and craft the role around their daily job requirements.  The role captures the required application entitlements.  To keep role explosion down, we use role mining in OIA and also meet and interview the business.  It is an iterative process to get role consensus. Q. Great presentation! How many rounds of Certifications has ING performed so far?  A. Around 7 quarters and constant certifications on transfer. Q. Did you have executive support from the top down   A. Yes  The executive support was key to our success. Q. For your cloud instance are you using OIA or OIM as SaaS?  A. No.  We are just provisioning and deprovisioning to various Cloud providers.  (Service Now is an example) Q. How do you ensure a role owner does not get more priviliges as are intended and thus violates another role, e,g, a DBA Roles should not get tor rigt to run somethings as root, as this would affect the root role? A. We have SOD  checks.  Also all Roles are initially approved by external audit and the role owners have to certify the roles and any changes Q. What is your ratio of employees to roles?   A. We are still in process going through our various lines of business, so I do not have a final ratio.  From what we have seen, the ratio varies greatly depending on the Line of Business and the diversity of Job Functions.  For standardized lines of business such as call centers, the ratio is very good where we can have a single role that covers many employees.  For specialized lines of business like treasury, it can be one or two people per role. Q. Is ING using Oracle On Demand service ?   A. No Q. Do you have to implement or migrate to OIM in order to get the Identity Warehouse, or can OIA provide the identity warehouse as well if you haven't reached OIM yet? A. No, OIM deployment is not required to implement OIA’s Identity Warehouse but as you heard during the webcast, there are tremendous deployment synergies in deploying both OIA and OIM together. Q. When is the Security Governor product coming out? A. Oracle Security Governor for Healthcare is available today. Hope you enjoyed the webcast and we look forward to having you join us for the next webcast in the Customers Talk: Identity as a Platform webcast series: Toyota: Putting Customers First – Identity Platform as a Business Enabler Wednesday, May 16th at 10 am PST/ 1 pm EST Register Today You can also register for a live event at a city near you where Aberdeen’s Derek Brink will discuss the survey results from the recently published report “Analyzing Platform vs. Point Solution Approach in Identity”. And, you can do a quick (& free)  online assessment of your identity programs by benchmarking it against the 160 organizations surveyed  in the Aberdeen report, compliments of Oracle. Here’s the slide deck from our ING webcast: ING webcast platform View more presentations from OracleIDM

    Read the article

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • Dynamic object property populator (without reflection)

    - by grenade
    I want to populate an object's properties without using reflection in a manner similar to the DynamicBuilder on CodeProject. The CodeProject example is tailored for populating entities using a DataReader or DataRecord. I use this in several DALs to good effect. Now I want to modify it to use a dictionary or other data agnostic object so that I can use it in non DAL code --places I currently use reflection. I know almost nothing about OpCodes and IL. I just know that it works well and is faster than reflection. I have tried to modify the CodeProject example and because of my ignorance with IL, I have gotten stuck on two lines. One of them deals with dbnulls and I'm pretty sure I can just lose it, but I don't know if the lines preceding and following it are related and which of them will also need to go. The other, I think, is the one that pulled the value out of the datarecord before and now needs to pull it out of the dictionary. I think I can replace the "getValueMethod" with my "property.Value" but I'm not sure. I'm open to alternative/better ways of skinning this cat too. Here's the code so far (the commented out lines are the ones I'm stuck on): using System; using System.Collections.Generic; using System.Reflection; using System.Reflection.Emit; public class Populator<T> { private delegate T Load(Dictionary<string, object> properties); private Load _handler; private Populator() { } public T Build(Dictionary<string, object> properties) { return _handler(properties); } public static Populator<T> CreateBuilder(Dictionary<string, object> properties) { //private static readonly MethodInfo getValueMethod = typeof(IDataRecord).GetMethod("get_Item", new [] { typeof(int) }); //private static readonly MethodInfo isDBNullMethod = typeof(IDataRecord).GetMethod("IsDBNull", new [] { typeof(int) }); Populator<T> dynamicBuilder = new Populator<T>(); DynamicMethod method = new DynamicMethod("Create", typeof(T), new[] { typeof(Dictionary<string, object>) }, typeof(T), true); ILGenerator generator = method.GetILGenerator(); LocalBuilder result = generator.DeclareLocal(typeof(T)); generator.Emit(OpCodes.Newobj, typeof(T).GetConstructor(Type.EmptyTypes)); generator.Emit(OpCodes.Stloc, result); int i = 0; foreach (var property in properties) { PropertyInfo propertyInfo = typeof(T).GetProperty(property.Key, BindingFlags.Public | BindingFlags.Instance | BindingFlags.IgnoreCase | BindingFlags.FlattenHierarchy | BindingFlags.Default); Label endIfLabel = generator.DefineLabel(); if (propertyInfo != null && propertyInfo.GetSetMethod() != null) { generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, isDBNullMethod); generator.Emit(OpCodes.Brtrue, endIfLabel); generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, getValueMethod); generator.Emit(OpCodes.Unbox_Any, property.Value.GetType()); generator.Emit(OpCodes.Callvirt, propertyInfo.GetSetMethod()); generator.MarkLabel(endIfLabel); } i++; } generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ret); dynamicBuilder._handler = (Load)method.CreateDelegate(typeof(Load)); return dynamicBuilder; } } EDIT: Using Marc Gravell's PropertyDescriptor implementation (with HyperDescriptor) the code is simplified a hundred-fold. I now have the following test: using System; using System.Collections.Generic; using System.ComponentModel; using Hyper.ComponentModel; namespace Test { class Person { public int Id { get; set; } public string Name { get; set; } } class Program { static void Main() { HyperTypeDescriptionProvider.Add(typeof(Person)); var properties = new Dictionary<string, object> { { "Id", 10 }, { "Name", "Fred Flintstone" } }; Person person = new Person(); DynamicUpdate(person, properties); Console.WriteLine("Id: {0}; Name: {1}", person.Id, person.Name); Console.ReadKey(); } public static void DynamicUpdate<T>(T entity, Dictionary<string, object> properties) { foreach (PropertyDescriptor propertyDescriptor in TypeDescriptor.GetProperties(typeof(T))) if (properties.ContainsKey(propertyDescriptor.Name)) propertyDescriptor.SetValue(entity, properties[propertyDescriptor.Name]); } } } Any comments on performance considerations for both TypeDescriptor.GetProperties() & PropertyDescriptor.SetValue() are welcome...

    Read the article

  • PASS Summit – looking back on my first time

    - by Fatherjack
      So I was lucky enough to get my first experience of PASS Summit this year and took some time beforehand to read some blogs and reference material to get an idea on what to do and how to get the best out of my visit. Having been to other conferences – technical and non-technical – I had a reasonable idea on the routine and what to expect in general. Here is a list of a few things that I have learned/remembered as the week has gone by. Wear comfortable shoes. This actually needs to be broadened to Take several pairs of comfortable shoes. You will be spending many many hours, for several days one after another. Having comfortable feet that can literally support you for the duration will make the week in general a whole lot better. Not only at the conference but getting to and from you could well be walking. In the evenings you will be walking around town and standing talking in various bars and clubs. Looking back, on some days I was on my feet for over 20 hours. Make friends. This is a given for the long term benefits it brings but there is also an immediate reward in being at a conference with a friend or two. Some events are bigger and more popular than others and some have the type of session that every single attendee will want to be in. This is great for those that get in but if you are in the bathroom or queuing for coffee and you miss out it sucks. Having a friend that can get in to a room and reserve you a seat is a great advantage to make sure you get the content that you want to see and still have the coffee that you need. Don’t go to every session you want to see This might sound counter intuitive and it relies on the sessions being recorded in some way to guarantee you don’t totally miss out. Both PASS Summit and SQL Bits sessions are recorded (summit is audio, SQLBits is video) and this means that if you get into a good conversation with someone over a coffee you don’t have to break it up to go to a session. Obviously there is a trade-off here and you need to decide on the tipping point for yourself but a conversation at a place like this could make a big difference to the next contract or employer you have or it might simply be great catching up with some friends you don’t see so often. Go to at least one session you don’t want to Again, this will seem to be contrary to normal logic but there is no reason why you shouldn’t learn about a part of SQL Server that isn’t part of your daily routine. Not only will you learn something new but you will also pick up on the feelings and attitudes of the people in the session. So, if you are a DBA, head off to a BI session and so on. You’ll hear BI speakers speaking to a BI audience and get to understand their point of view and reasoning for making the decisions they do. You will also appreciate the way that your decisions and instructions affect the way they have to work. This will help you a lot when you are on a project, working with multiple teams and make you all more productive. Socialise While you are at the conference venue, speak to people. Ask questions, be interested in whoever you are speaking to. You get chances to talk to new friends at breakfast, dinner and every break between sessions. The only people that might not talk to you would be speakers that are about to go and give a session, in most cases speakers like peace and quiet before going on stage. Other than that the people around you are just waiting for someone to talk to them so make the first move. There is a whole lot going on outside of the conference hours and you should make an effort to join in with some of this too. At karaoke evenings or just out for a quiet drink with a few of the people you meet at the conference. Either way, don’t be a recluse and hide in your room or be alone out in the town. Don’t talk to people Once again this sounds wrong but stay with me. I have spoken to a number of speakers since Summit 2013 finished and they have all mentioned the time it has taken them to move about the conference venue due to people stopping them for a chat or to ask a question. 45 minutes to walk from a session room to the speaker room in one case. Wow. While none of the speakers were upset about this sort of delay I think delegates should take the situation into account and possibly defer their question to an email or to a time when the person they want is clearly less in demand. Give them a chance to enjoy the conference in the same way that you are, they may actually want to go to a session or just have a rest after giving their session – talking for 75 minutes is hard work, taking an extra 45 minutes right after is unbelievable. I certainly hope that they get good feedback on their sessions and perhaps if you spoke to a speaker outside a session you can give them a mention in the ‘any other comments’ part of the feedback, just to convey your gratitude for them giving up their time and expertise for free. Say thank you I just mentioned giving the speakers a clear, visible ‘thank you’ in the feedback but there are plenty of people that help make any conference the success it is that would really appreciate hearing that their efforts are valued. People on the registration desk, volunteers giving schedule guidance and directions, people on the community zone are all volunteers giving their time to help you have the best experience possible. Send an email to PASS and convey your thoughts about the work that was done. Maybe you want to be a volunteer next time so you could enquire how you get into that position at the same time. This isn’t an exclusive list and you may agree or disagree with the points I have made, please add anything you think is good advice in the comments. I’d like to finish by saying a huge thank you to all the people involved in planning, facilitating and executing the PASS Summit 2013, it was an excellent event and I know many others think it was a totally worthwhile event to attend.

    Read the article

  • DBA Best Practices - A Blog Series: Episode 1 - Backups

    - by Argenis
      This blog post is part of the DBA Best Practices series, on which various topics of concern for daily database operations are discussed. Your feedback and comments are very much welcome, so please drop by the comments section and be sure to leave your thoughts on the subject. Morning Coffee When I was a DBA, the first thing I did when I sat down at my desk at work was checking that all backups have completed successfully. It really was more of a ritual, since I had a dual system in place to check for backup completion: 1) the scheduled agent jobs to back up the databases were set to alert the NOC in failure, and 2) I had a script run from a central server every so often to check for any backup failures. Why the redundancy, you might ask. Well, for one I was once bitten by the fact that database mail doesn't work 100% of the time. Potential causes for failure include issues on the SMTP box that relays your server email, firewall problems, DNS issues, etc. And so to be sure that my backups completed fine, I needed to rely on a mechanism other than having the servers do the taking - I needed to interrogate the servers and ask each one if an issue had occurred. This is why I had a script run every so often. Some of you might have monitoring tools in place like Microsoft System Center Operations Manager (SCOM) or similar 3rd party products that would track all these things for you. But at that moment, we had no resort but to write our own Powershell scripts to do it. Now it goes without saying that if you don't have backups in place, you might as well find another career. Your most sacred job as a DBA is to protect the data from a disaster, and only properly safeguarded backups can offer you peace of mind here. "But, we have a cluster...we don't need backups" Sadly I've heard this line more than I would have liked to. You need to understand that a cluster is comprised of shared storage, and that is precisely your single point of failure. A cluster will protect you from an issue at the Operating System level, and also under an outage of any SQL-related service or dependent devices. But it will most definitely NOT protect you against corruption, nor will it protect you against somebody deleting data from a table - accidentally or otherwise. Backup, fine. How often do I take a backup? The answer to this is something you will hear frequently when working with databases: it depends. What does it depend on? For one, you need to understand how much data your business is willing to lose. This is what's called Recovery Point Objective, or RPO. If you don't know how much data your business is willing to lose, you need to have an honest and realistic conversation about data loss expectations with your customers, internal or external. From my experience, their first answer to the question "how much data loss can you withstand?" will be "zero". In that case, you will need to explain how zero data loss is very difficult and very costly to achieve, even in today's computing environments. Do you want to go ahead and take full backups of all your databases every hour, or even every day? Probably not, because of the impact that taking a full backup can have on a system. That's what differential and transaction log backups are for. Have I answered the question of how often to take a backup? No, and I did that on purpose. You need to think about how much time you have to recover from any event that requires you to restore your databases. This is what's called Recovery Time Objective. Again, if you go ask your customer how long of an outage they can withstand, at first you will get a completely unrealistic number - and that will be your starting point for discussing a solution that is cost effective. The point that I'm trying to get across is that you need to have a plan. This plan needs to be practiced, and tested. Like a football playbook, you need to rehearse the moves you'll perform when the time comes. How often is up to you, and the objective is that you feel better about yourself and the steps you need to follow when emergency strikes. A backup is nothing more than an untested restore Backups are files. Files are prone to corruption. Put those two together and realize how you feel about those backups sitting on that network drive. When was the last time you restored any of those? Restoring your backups on another box - that, by the way, doesn't have to match the specs of your production server - will give you two things: 1) peace of mind, because now you know that your backups are good and 2) a place to offload your consistency checks with DBCC CHECKDB or any of the other DBCC commands like CHECKTABLE or CHECKCATALOG. This is a great strategy for VLDBs that cannot withstand the additional load created by the consistency checks. If you choose to offload your consistency checks to another server though, be sure to run DBCC CHECKDB WITH PHYSICALONLY on the production server, and if you're using SQL Server 2008 R2 SP1 CU4 and above, be sure to enable traceflags 2562 and/or 2549, which will speed up the PHYSICALONLY checks further - you can read more about this enhancement here. Back to the "How Often" question for a second. If you have the disk, and the network latency, and the system resources to do so, why not backup the transaction log often? As in, every 5 minutes, or even less than that? There's not much downside to doing it, as you will have to clear the log with a backup sooner than later, lest you risk running out space on your tlog, or even your drive. The one drawback to this approach is that you will have more files to deal with at restore time, and processing each file will add a bit of extra time to the entire process. But it might be worth that time knowing that you minimized the amount of data lost. Again, test your plan to make sure that it matches your particular needs. Where to back up to? Network share? Locally? SAN volume? This is another topic where everybody has a favorite choice. So, I'll stick to mentioning what I like to do and what I consider to be the best practice in this regard. I like to backup to a SAN volume, i.e., a drive that actually lives in the SAN, and can be easily attached to another server in a pinch, saving you valuable time - you wouldn't need to restore files on the network (slow) or pull out drives out a dead server (been there, done that, it’s also slow!). The key is to have a copy of those backup files made quickly, and, if at all possible, to a remote target on a different datacenter - or even the cloud. There are plenty of solutions out there that can help you put such a solution together. That right there is the first step towards a practical Disaster Recovery plan. But there's much more to DR, and that's material for a different blog post in this series.

    Read the article

  • Advice for a distracted, unhappy, recently graduated programmer? [closed]

    - by Re-Invent
    I graduated 4 months ago. I had offers from a few good places to work at. At the same time I wanted to stick to building a small software business of my own, still have some ideas with good potential, some half done projects frozen in my github. But due to social pressures, I chose a job, the pay is great, but I am half-passionate about it. A small team of smart folks building useful product, working out contracts across the world. I've started finding it extremely boring. Boring to the extent that I skip 2-3 days a week together not doing work. Neither do I spend that time progressing any of my own projects. Yes, I feel stupid at the way I'm wasting time, but I don't understand exactly why is it happening. It's as if all the excitement has been drained. What can I do about it? Long version: School - I was in third standard. Only students, 6th grade had access to computer labs. I once peeked into the lab from the little door opening. No hard-disks, MS DOS on 5 1/2 inch floppies. I asked a senior student to play some sound in BASIC. He used PLAY to compose a tune. Boy! I was so excited, I was jumping from within. Back home, asked my brother to teach me some programming. We bought a book "MODERN All About GW-BASIC for Schools & Colleges". The book had everything, right from printing, to taking input, file i/o, game programming, machine level support, etc. I was in 6th standard, wrote my first game - a wheel of fortune, rotated the wheel by manipulating 16 color palette's definition. Got internet soon, got hooked to QuickBasic programming community. Made some more games "007 in Danger", "Car Crush 2" for submission to allbasiccode archives. I was extremely excited about all this. My interests now swayed into "hacking" (computer security). Taught myself some perl, found it annoying, learnt PHP and a bit of SQL. Also taught myself Visual Basic one of the winters and wrote a pacman clone with Direct X. By the time I was in 10th standard, I created some evil tools using visual basic, php and mysql and eventually landed myself into an unpaid side-job at a government facility, building evil tools for them. It was a dream come true for crackers of that time. And so was I, still very excited. Things changed soon, last two years of school were not so great as I was balancing preps for college, work at govt. and studies for school at same time. College - College was opposite of all I had wished it to be. I imagined it to be a place where I'd spend my 4 years building something awesome. It was rather an epitome of rote learning, attendance, rules, busy schedules, ban on personal laptops, hardly any hackers surrounding you and shit like that. We had to take permissions to even introduce some cultural/creative activities in our annual schedule. The labs won't be open on weekends because the lab employees had to have their leaves. Yes, a horrible place for someone like me. I still managed to pull out a project with a friend over 2 months. Showed it to people high in the academia hierarchy. They were immensely impressed, we proposed to allow personal computers for students. They made up half-assed reasons and didn't agree. We felt frustrated. And so on, I still managed to teach myself new languages, do new projects of my own, do an intern at the same govt. facility, start a small business for sometime, give a talk at a conference I'm passionate about, win game-dev and hacking contest at most respected colleges, solve good deal of programming contest problems, etc. At the same time I was not content with all these restrictions, great emphasis on rote learning, and sheer wastage of time due to college. I never felt I was overdoing, but now I feel I burnt myself out. During my last days at college, I did an intern at a bigco. While I spent my time building prototypes for certain LBS, the other interns around me, even a good friend, was just skipping time. I thought maybe, in a few weeks he would put in some serious efforts at work assigned to him, but all he did was to find creative ways to skip work, hide his face from manager, engage people in talks if they try to question his progress, etc. I tried a few time to get him on track, but it seems all he wanted was to "not to work hard at all and still reap the fruits". I don't know how others take such people, but I find their vicinity very very poisonous to one's own motivation and productivity. Over that, the place where I come from, HRs don't give much value to what have you done past 4 years. So towards the end of out intern, we all were offered work at the bigco, but the slacker, even after not writing more than 200 lines of code was made a much better offer. I felt enraged instantly - "Is this how the corp world treats someone who does fruitful, if not extra-ordinary work form them for past 6 months?". Yes, I did try to negotiate and debate. The bigcos seem blind due to departmentalization of responsibilities and many layers of management. I decided not to be in touch with any characters of that depressing play. Probably the busy time I had at college, ignoring friends, ignoring fun and squeezing every bit of free time for myself is also responsible. Probably this is what has drained all my willingness to work for anyone. I find my day job boring, at the same time I with to maintain it for financial reasons. I feel a bit burnt out, unsatisfied and at the same time an urge to quit working for someone else and start finishing my frozen side-projects (which may be profitable). Though I haven't got much to support myself with food, office, internet bills, etc in savings. I still have my day job, but I don't find it very interesting, even though the pay is higher than the slacker, I don't find money to be a great motivator here. I keep comparing myself to my past version. I wonder how to get rid of this and reboot myself back to the way I was in school days - excited about it, tinkering, building, learning new things daily, and NOT BORED?

    Read the article

  • Projected Results

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

    Read the article

  • Simplifying Human Capital Management with Mobile Applications

    - by HCM-Oracle
    By Aaron Green If you're starting to think 'mobility' is a recurring theme in your reading, you'd be right. For those who haven't started to build organisational capabilities to leverage it, it's fair to say you're late to the party. The good news: better late than never. Research firm eMarketer says the worldwide smartphone audience will total 1.75 billion this year, while communications technology and services provider Ericsson suggests smartphones will triple to 5.6 billion globally by 2019. It should be no surprise, smart phone adoption is reaching the farthest corners of the globe; the subsequent impact of enterprise applications enabled by these devices is driving business performance improvement and will continue to do so. Companies using advanced workforce analytics can add significantly to the bottom line, while impacting customer satisfaction, quality and productivity. It's a statement that makes most business leaders sit forward in their chairs. Achieving these three standards is like sipping The Golden Elixir for the business world. No-one would argue their importance. So what are 'advanced workforce analytics?' Simply, they're unprecedented access to workforce trends and performance markers. Many are made possible by a mobile world and the enterprise applications that come with it on smart devices. Some refer to it as 'the consumerisation of IT'. As this phenomenon has matured and become more widely appreciated it has impacted the spectrum of functional units within an enterprise differently, but powerfully. Whether it's sales, HR, marketing, IT, or operations, all have benefited from a more mobile approach. It has been the catalyst for improvement in, and management of, the employee experience. The net result of which is happier customers. The obvious benefits but the lesser realised impact Most people understand that mobility allows for greater efficiency and productivity, collaboration and flexibility, but how that translates into business outcomes within the various functional groups is lesser known. In actuality mobility has helped galvanise partnerships between cross-functional groups within the enterprise. Where in some quarters it was once feared mobility could fragment a workforce, its rallying cry of support is coming from what you might describe as an unlikely source - HR. As the bedrock of an enterprise, it is conceivable HR might contemplate the possible negative impact of a mobile workforce that no-longer sits in an office, at the same desks every day. After all, who would know what they were doing or saying? How would they collaborate? It's reasonable to see why HR might have a legitimate claim to try and retain as much 'perceived control' as possible. The reality however is mobility has emancipated human capital and its management. Mobility and enterprise applications are expediting decision making. Google calls it Zero Moment of Truth, or ZMOT. It enables smoother operation and can contribute to faster growth. From a collaborative perspective, with the growing use of enterprise social media, which in many cases is being driven by HR, workforce planning and the tangible impact of change is much easier to map. This in turn provides a platform from which individuals and teams can thrive. With more agility and ability to anticipate, staff satisfaction and retention is higher, and real time feedback constant. The management team can save time, energy and costs with more accurate data, which is then intelligently applied across the workforce to truly engage with staff, customers and partners. From a human capital management (HCM) perspective, mobility can help you close the loop on true talent management. It can enhance what managers can offer and what employees can provide in return. It can create nested relationships and powerful partnerships. IT and HR - partners and stewards of mobility One effect of enterprise mobility is an evolution in the nature of the relationship between HR and IT from one of service provision to partnership. The reason for the dynamic shift is largely due to the 'bring your own device' (BYOD) movement, which is transitioning to a 'bring your own application' (BYOA) scenario. As enterprise technology has in some ways reverse-engineered its solutions to help manage this situation, the partnership between IT (the functional owner) and HR (the strategic enabler) is deeply entrenched. And it has to be. The CIO and the HR leader are faced with compliance and regulatory issues and concerns around information security and personal privacy on a daily basis, complicated by global reach and varied domestic legislation. There are tens of thousands of new mobile apps entering the market each month and, unlike many consumer applications which get downloaded but are often never opened again after initial perusal, enterprise applications are being relied upon by functional groups, not least by HR to enhance people management. It requires a systematic approach across all applications in use within the enterprise in order to ensure they're used to best effect. No turning back, and no desire to With real time analytics on performance and the ability for immediate feedback, there is no turning back for managers. In my experience with Oracle, our customers' operational efficiency is at record levels. It's clear as a result of the combination of individual KPIs and organisational goals, CIOs have been able to give HR leaders the ability to build predictive models that feed into an enterprise organisations' evolving strategy. It also helps them ensure regulatory compliance much more easily. Once an arduous task, with mobile enabled automation and quality data, compliance is simpler. Their world has changed for the better. For the CIO, mobility also assists them to optimise performance. While it doesn't come without challenges, mobile-enabled applications and the native experience users have with them means employees don't need high-level technical expertise to train users. It reduces the training and engagement required from the IT team so they can focus on other things that deliver value to the bottom line; all the while lowering the cost of assets and related maintenance work by simplifying processes. Rewards of a mobile enterprise outweigh risks With mobile tools allowing us to increasingly integrate our personal and professional lives, terms like "office hours" are becoming irrelevant, so work/life balance is a cultural must. Enterprises are expected to offer tools that enable workers to access information from anywhere, at any time, from any device. Employees want simplicity and convenience but it doesn't stop at private enterprise. This is a societal shift. Governments, which traditionally have been known to be slower to adopt newer technology, are also offering support for local businesses to go mobile. Several state government websites have advice on how to create mobile apps and more. And as recently as last week the Victorian Minister for Technology Gordon Rich-Phillips unveiled his State government's ICT roadmap for the next two years, which details an increased use of the public cloud, as well as mobile communications, and improved access to online data-sets. Tech giants are investing significantly in solutions designed to simplify mobile deployment and enablement. The mobility trend is creating a wave of change in the industry and driving transformation in the enterprise. If you're not on that wave, the business risk continues to rise as your competitiveness drops. Aaron is the Vice President of HCM Strategy at Oracle Corporation where he is responsible for researching and identifying emerging trends in the practice of Human Resources and works to deliver industry-leading technology solutions. Other responsibilities include, ownership of Oracle's innovative HCM solutions across JAPAC and enabling organisations to transform and modernise their workforce tools. Follow him on Twitter @aaronjgreen

    Read the article

  • Table not Echoing out if another Table has a Zero value

    - by John
    Hello, The table below with mysql_query($sqlStr3) (the one with the word "Joined" in its row) does not echo if the result associated with mysql_query($sqlStr1) has a value of zero. This happens even if mysql_query($sqlStr3) returns a result. In other words, if a given loginid has an entry in the table "login", but not one in the table "submission", then the table associated with mysql_query($sqlStr3) does not echo. I don't understand why the "submission" table would have any effect on mysql_query($sqlStr3), since the $sqlStr3 only deals with another table, called "login", as seen below. Any ideas why this is happening? Thanks in advance, John W. <?php echo '<div class="profilename">User Profile for </div>'; echo '<div class="profilename2">'.$profile.'</div>'; $tzFrom = new DateTimeZone('America/New_York'); $tzTo = new DateTimeZone('America/Phoenix'); $profile = mysql_real_escape_string($_GET['profile']); $sqlStr = "SELECT l.username, l.loginid, s.loginid, s.submissionid, s.title, s.url, s.datesubmitted, s.displayurl FROM submission AS s INNER JOIN login AS l ON s.loginid = l.loginid WHERE l.username = '$profile' ORDER BY s.datesubmitted DESC"; $result = mysql_query($sqlStr); $arr = array(); echo "<table class=\"samplesrec1\">"; while ($row = mysql_fetch_array($result)) { $dt = new DateTime($row["datesubmitted"], $tzFrom); $dt->setTimezone($tzTo); echo '<tr>'; echo '<td class="sitename3">'.$dt->format('F j, Y &\nb\sp &\nb\sp g:i a').'</a></td>'; echo '<td class="sitename1"><a href="http://www.'.$row["url"].'">'.$row["title"].'</a></td>'; echo '</tr>'; } echo "</table>"; $sqlStr1 = "SELECT l.username, l.loginid, s.loginid, s.submissionid, s.title, s.url, s.datesubmitted, s.displayurl, l.created, count(s.submissionid) countSubmissions FROM submission AS s INNER JOIN login AS l ON s.loginid = l.loginid WHERE l.username = '$profile'"; $result1 = mysql_query($sqlStr1); $arr1 = array(); echo "<table class=\"samplesrec2\">"; while ($row1 = mysql_fetch_array($result1)) { echo '<tr>'; echo '<td class="sitename5">Submissions: &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;'.$row1["countSubmissions"].'</td>'; echo '</tr>'; } echo "</table>"; $sqlStr2 = "SELECT l.username, l.loginid, c.loginid, c.commentid, c.submissionid, c.comment, c.datecommented, l.created, count(c.commentid) countComments FROM comment AS c INNER JOIN login AS l ON c.loginid = l.loginid WHERE l.username = '$profile'"; $result2 = mysql_query($sqlStr2); $arr2 = array(); echo "<table class=\"samplesrec3\">"; while ($row2 = mysql_fetch_array($result2)) { echo '<tr>'; echo '<td class="sitename5">Comments: &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;'.$row2["countComments"].'</td>'; echo '</tr>'; } echo "</table>"; $tzFrom3 = new DateTimeZone('America/New_York'); $tzTo3 = new DateTimeZone('America/Phoenix'); $sqlStr3 = "SELECT created, username FROM login WHERE username = '$profile'"; $result3 = mysql_query($sqlStr3); $arr3 = array(); echo "<table class=\"samplesrec4\">"; while ($row3 = mysql_fetch_array($result3)) { $dt3 = new DateTime($row3["created"], $tzFrom3); $dt3->setTimezone($tzTo3); echo '<tr>'; echo '<td class="sitename5">Joined: &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;'.$dt->format('F j, Y').'</td>'; echo '</tr>'; } echo "</table>"; ?> </body> </html>

    Read the article

< Previous Page | 146 147 148 149 150 151 152 153 154  | Next Page >