Search Results

Search found 7299 results on 292 pages for 'dan short'.

Page 150/292 | < Previous Page | 146 147 148 149 150 151 152 153 154 155 156 157  | Next Page >

  • Open application in background without losing current window focus. Fedora 17, Gnome 3

    - by Ishan
    I'm running a script in the background which loads an image with feh depending on which application is currently in focus. However, whenever the script opens the image, window focus is lost to feh. I was able to circumvent this by using xdotool to switch back to the application that was originally in focus, but this introduces a short annoying period of time where the focus is switched from feh to the application. My question is this: is there any way to launch feh in the background such that window focus is NOT lost? System: Fedora 17, Gnome 3, Bash Thanks a ton!

    Read the article

  • Bringing my Dell XPS 13 ultrabook back to factory state

    - by TysHTTP
    I have a brand new Dell XPS 13 ultra book. After i picked it up at the store, i wiped the exising partitions which also contained the restore/rescue data, which you need to reinstall the factory version of Windows 8 that comes with this machine. I did this because we have a different MS partner edition of Windows which i prefer to run. After doing all this, i noticed that there was something wrong with machine. No real damage, but the specs are not completely as they should be. Turned out that a simple mistake while ordering. Now, long story short, the shop says that it has no problem with taking the product back, as long as it is in it's original state. And this is the problem i'm having, because i formatted the original partitions that contain that rescue option / windows 8 setup, i don't have a clue whether it's possible to get back to that original. Does anyone have an idea on how to get this fixed?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Why can't email clients create rules for moving dates like "yesterday"?

    - by Morgan
    I've never seen an email client that I could easily create a rule to do something like "Move messages from yesterday to a folder?" Is there some esoteric reason why this would be difficult? I know I can easily create rules around specific dates, but that isn't the same thing by a long shot; am I missing something? In Outlook 2010 I can create search folders that do sort of this type of thing, but you can't create rules around a search folder... seems like either I am missing something major, or this is terribly short-sided.

    Read the article

  • Fusion 3, Windows 7, frequent blue screens

    - by kenny6127
    Is anyone else seeing this problem? A solution would be great (hey, it's Windows, it's gonna blue screen, just gotta deal with it), but it's also nice to know if it's something specific to my configuration, or if a lot of folks are having the same issue. Here's the details: * MacBook Pro 15" unibody, 4 GB, 2.4 GHz, 10.5.8 * Fusion 3.0.1 * Windows 7 Pro, 32-bit (clean install, not migrated from Boot Camp or anything) Blue screens happen nearly every time the MBP cover is closed for a short period of time (< 3 minutes). If the cover is closed for a half hour or longer, the VM is fine. I'm guessing it might be related to sleep, but that's hard to tell, and the Windows crash dump logs are pretty useless. Thanks!

    Read the article

  • How to rotate attached monitor to notebook of Sony's Z-series?

    - by user67175
    Is it possible that Sony is selling a top of the line, hugely expensive computer that does not have the basic ability to rotate an attached monitor? Is it possible that the Z-series simply can't do this? The Windows control panel is missing the normal option for "rotation", as is the Nvidia control panel for "orientation" , no additional rotation software works. Sony sales says they do not know the answer to this. Sony technical supports says that the problem lies with Nvidia, Nvidia technical supports says the problem lies with Sony. Any advice for a fix for this short of returning the computer would be greatly appreciated. Also wondering if this problem is common to computers running Windows 7?

    Read the article

  • Apache+FastCGI Timeout Error: "has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds"

    - by Sadjad Fouladi
    I've recently installed mod_fastcgi and Apache 2.2. I have a simple cgi script as below (test.fcgi): #!/bin/sh echo sadjad But when I invoke 'mysite.com/test.fcgi' I see "Internal Server Error" after a short period of time. The error.log file shows this error message: [Tue Jan 31 22:23:57 2006] [warn] FastCGI: (dynamic) server "~/public_html/oaduluth/dispatch.fcgi" has failed to remain running for 30 seconds given 3 attempts, its restart interval has been backed off to 600 seconds This is my .htaccess file: AddHandler fastcgi-script .fcgi RewriteEngine On RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^(.*)$ django.fcgi/$1 [QSA,L] What could the problem be? Is it my .htaccess file?

    Read the article

  • Run totally silent rsync?

    - by jackr
    I have a cronjob that runs hourly, and is totally silent unless something goes wrong. Well ... almost ... A part of the job is rsync --del -Cacqrz public/. [email protected]:/target/path This always prints "logged in". How can I make it stop? (Short of 'grep -v' ;-) I don't get the "logged in" message if I do things like ssh [email protected] ls The transport is, of course, ssh (using keys). Source host is either OSX or Ubuntu (tried both, same behavior). Target host is Linux of some flavor.

    Read the article

  • I would like to pipe output of find into input list of scp, how?

    - by user13184
    I'm a novice linux user and I am trying to send a long list of files from one computer to another. The argument list is too long, so I am using find. I am having trouble setting up the expression, though. Can someone help? Here is what I would normally type for a short argument list. scp ./* phogan@computer/directory... Here's I think this might translate into with find. scp find . -name "*" phogan@computer/directory... Maybe I could use piping? Any suggestions would help. Thanks in advance.

    Read the article

  • Migrate servers without losing any data / time-limited MySQL dump?

    - by inac
    Is there a way to migrate from an old dedicated server to a new one without losing any data in-between - and with no downtime? In the past, I've had to lose MySQL data between the time when the new server goes up (i.e., all files transferred, system up and ready), and when I take the old server down (data still transferred to old until new one takes over). There is also a short period where both are down for DNS, etc., to refresh. Is there a way for MySQL/root to easily transfer all data that was updated/inserted between a certain time frame?

    Read the article

  • Access boot menu from windows 7

    - by repsak
    I busted my keyboard on my laptop, and now my computer rarely starts since it doesnt ignore this problem when booting. So what i want to do, is to disable my keyboard from the boot menu. But I cant access the boot menu since my keyboard doesnt work. I have an addtional keybaord via USB but that one doesnt work before windows is booted. So in short, what I want is to access my laptops boot menu now when im on windows via cmd, but im not sure how to do it.

    Read the article

  • Access boot menu from windows 7

    - by repsak
    I busted my keyboard on my laptop, and now my computer rarely starts since it doesnt ignore this problem when booting. So what i want to do, is to disable my keyboard from the boot menu. But I cant access the boot menu since my keyboard doesnt work. I have an addtional keybaord via USB but that one doesnt work before windows is booted. So in short, what I want is to access my laptops boot menu now when im on windows via cmd, but im not sure how to do it.

    Read the article

  • Will 5 Terabyte NAS drive be compatible with Windows XP SP3 32 bit?

    - by TrevorBoydSmith
    (NOTE: The operating system (in this case Windows XP SP3 32 bit) we are using is not a choice.) I am trying to setup a short term storage device. First, I found a large 5 Terabyte NAS drive that would IMO fulfill my storage requirements. Second, I also found that Windows XP seems to have a hard drive size limit (see 'Is there a limit to the size of a hard drive for Windows XP pre-SP1?'): XP should handle up to 2 TB per volume after the service packs are applied. You are correct. There was a 137gb limit on the orginal pre service pack windows xp. This was addressed/fixed in SP1. My question is, will my Windows XP SP3 32 bit machine see the 5 Terabyte NAS and be able to read/write properly to the NAS drive?

    Read the article

  • Stream computer screen to TV via network instead of a USB wireless link

    - by user24559
    I want to stream my computer screen (not just video or a limited amount of content) to my TV via the network. I know there are wireless devices that use USB to tranfer the screen to the TV. However, these are limited to a short distance. What I want to do is stream the data via the network so I can be anywhere within the network and have the data shown on the tv. I am looking for video and sound to transfer. I want the entire computer screen to transfer just like when you connect the computer to the tv via VGA or HDMI and the sound out using the 3.5mm plug. I have been unable to find a unit that allows for the entire computer screen to transfer via the network. I just find the ability to stream video. I am using Windows 7 Ultimate with a quad processor and 16 GB of memory so I have the power to handle the transfer. My tv is hdtv.

    Read the article

  • How to secure a VM while allowing customer RDS (or equivalent) access to its desktop

    - by ChrisA
    We have a Windows Client/(SQL-)Server application which is normally installed at the customer's premises. We now need to provide a hosted solution, and browser-based isn't feasible in the short term. We're considering hosting the database ourselves, and also hosting the client in a VM. We can set all this up easily enough, so we need to: ensure that the customer can connect easily, and also ensure that we suitably restrict access to the VM (and its host, of course) We already access the host and guest machines across the internet via RDS, but we restrict access to it to only our own internal, very small, set of static IPs, and of course theres the 2 (or 3?)-user limit on RDS connections to a remote server. So I'd greatly appreciate ideas on how to manage: the security the multi-user aspect. We're hoping to be able to do this initially without a large investment in virtualisation infrastructure - it would be one customer only to start with, with perhaps two remote users. Thanks!

    Read the article

  • ALT+TAB doesn't work properly in Windows 8.1

    - by Marco1
    Holding ALT+TAB will activate the flip 2D to switch from a window to another. The problem is that this function remains active for a very short time and I'm not able to select the window I want in the foreground. I also noticed that when I put the cursor on an icon on the taskbar, the live preview thumbnail disappears quickly. With a safe mode restart the problem is no longer there, all is fine! With a clean install of Windows 8.1(no driver and applications installed) the problem is here again; obviously disappears with a safe mode restart also in this situation. What's the problem? A Windows process or service?

    Read the article

  • Boost Up My Old Laptop Using a SSD

    - by Sina Bizbone
    I have an old laptop Lenovo SL400 (Core2Due T9550 2.66GHz / 4GB DDR2 Ram). Since I can't afford to buy a new laptop, I thought maybe I could throw an ADATA SP600 64GB SSD as primary drive and move my current HDD to DVD-ROM space by using HDDCADDY. I know that 64gb will come short after installing Visual Studio, SQL Server, etc. So is there anyway to just install the kernel part of windows on SSD and the rest on HDD. Doesn't windows have built-in support to do this? (ReadyBoost is out of picture since it's just simple caching)

    Read the article

  • Fatal error: Call to a member function escape() on a non-object in .....on line 10

    - by danyo
    i am making a simple javascript login form for wordpress. i have the form submitting to the following bit of php to handle the login: <?php get_header(); global $user_ID; if (!$user_ID) { if($_POST){ //We shall SQL escape all inputs $username = $wpdb->escape($_REQUEST['username']); $password = $wpdb->escape($_REQUEST['password']); $remember = $wpdb->escape($_REQUEST['rememberme']); if($remember) $remember = "true"; else $remember = "false"; $login_data = array(); $login_data['user_login'] = $username; $login_data['user_password'] = $password; $login_data['remember'] = $remember; $user_verify = wp_signon( $login_data, false ); //wp_signon is a wordpress function which authenticates a user. It accepts user info parameters as an array. if ( is_wp_error($user_verify) ) { echo "<span class='error'>Invalid username or password. Please try again!</span>"; exit(); } else { echo "<script type='text/javascript'>window.location='". get_bloginfo('url') ."'</script>"; exit(); } } else { //get_header(); ?> any ideas on why i am getting the error? Cheers, Dan

    Read the article

  • SSH - SFTP/SCP only + additional command running in background

    - by Chris
    there are many solutions described to get ur SSH-connection forced to only run SFTP by modifying the sshd_config by adding a new group match and give that new group a Forcecommand internal-sftp Well that works great but i would love to have a little more feature. My servers automatically ban IP's which try to connect often in a short time. So when you use any SFTP-Client, which opens multiple connections to work faster it can get banned instandly by the server for a long time. The servers have a script to whitelist users by administrator. I've modified this script to whitelist the user, which runs the script. All i need to do is now get the server to execute that script, when somebody logins. On SSH it's no problem, just put it in .bashrc or something like, but the Forcecommand don't runs these scripts on login. Is there any way to run such a shellscript before or at the same time as the Forcecommand get fired?

    Read the article

  • How can I use my Windows 7 computer to share WiFi connection with PCs that don't have wireless?

    - by Tom Auger
    Long story short: modem and wireless router are downstairs and we're having a LAN party where some visitors don't have wireless. There's no way to run the length of cabling required, so looking for options. My Windows 7 Home Premium PC has a wireless-n connection, and I'd like to see if I can use it as a "hub" or switch of sorts, running an ethernet cable out of the back and into a switch, then splitting off to the other PCs. Is this an option? I know with Internet sharing, you can set up your PC as a wireless access point, but I want to do the opposite.

    Read the article

  • Ubuntu Lucid (10.04) subpixel font rendering crashes Xorg

    - by user36066
    Hi everyone... I really don't know how to solve this on my own so I thought giving this site a chance. After upgrading to Lucid I ran into some problems. With some experimenting I came to a conclusion that if I enable subpixel smoothing on fonts the moment I start any other application not native to GTK+ (wine, openoffice, wxWidgets, ...) my X server crashes the same moment. At first this seemed like something went wrong during installation. To cut the long story short, after 3 clean installations and whole bunch of experimenting the same thing happens all over again. Strange thing is... if I configure any other font smoothing besides subpixel, everything works like it should. Any thoughs?

    Read the article

  • Shortcut for "show in folder" in Windows 7

    - by richardh
    I'm new to Windows (former Mac user) and using Windows 7 for about two months now. I almost exclusively use the taskbar to navigate to files (i.e., I press the Win/meta key and start typing... my libraries and naming conventions make it pretty easy to get the correct file). Then I press enter and the file opens. Awesome. But sometimes I want to see the file in its folder (i.e., maybe I want to rename, move, copy, etc.). To do this I need to mouse/trackpad over and right click to get the "show in folder" options. Is there another way short of searching for the folder name instead? Is there a hotkey/shortcut for "show in folder"? Thanks!

    Read the article

  • Download web server structure with empty files

    - by golimar
    I want to make a mirror of a Web server, but downloading the actual files will take too long. So I thought of having just the directory and file structure, and when I need the actual contents of the file, I can download just that file. I have tried wget --spider URL and in a short time it has created in my local disk the directory structure with no files. But I've checked all of wget's or curl's switches and there is nothing like what I need. Can this be done with wget, curl or any other tool?

    Read the article

  • Fixing Windows 7 explorer issues

    - by Cegorach
    OK, so here is the problem I'm hoping you guys can help me fix. On my Win7-Ult64 box, my explorer (among other things) has decided not to work. For example, if I try to use a program, say Chrome, to open a folder, I will get the message "Class not registered" (and its not program specific). In the same vein, when I go to Start-Rclick Computer-properties, nothing happens, but I can go to control panel-system properties and it will work. And other items in the control panel do nothing when I click them (and I have a feeling it is all tied together). I have already done multiple virus and spyware sweeps, so I know that isn't the problem. Any suggestions on what could be causing this/how to fix it (short of nuke and boot)?

    Read the article

  • In a virtual machine monitor such as VMware’s ESXi Server, how are shadow page tables implemented?

    - by ali01
    My understanding is that VMMs such as VMware's ESXi Server maintain shadow page tables to map virtual page addresses of guest operating systems directly to machine (hardware) addresses. I've been told that shadow page tables are then used directly by the processor's paging hardware to allow memory access in the VM to execute without translation overhead. I would like to understand a bit more about how the shadow page table mechanism works in a VMM. Is my high level understanding above correct? What kind of data structures are used in the implementation of shadow page tables? What is the flow of control from the guest operating system all the way to the hardware? How are memory access translations made for a guest operating system before its shadow page table is populated? How is page sharing supported? Short of straight up reading the source code of an open source VMM, what resources can I look into to learn more about hardware virtualization?

    Read the article

< Previous Page | 146 147 148 149 150 151 152 153 154 155 156 157  | Next Page >