Search Results

Search found 85419 results on 3417 pages for 'jquery file upload'.

Page 150/3417 | < Previous Page | 146 147 148 149 150 151 152 153 154 155 156 157  | Next Page >

  • change background color with change in mouse position

    - by Ashish Rajan
    I was wondering if it is possible to set background-color with help of mouse coordinates. What is have is: I have a DIV-A which is draggable and some other divs which are droppable. What is need is : I need to highlight other divs on my page which are droppable, whenever my DIV-A passes over them. What i have is mouse coordinates, is it possible to apply css on the bases of mouse coordinates using jquery.

    Read the article

  • Check if cookie exists if not create it.

    - by Ozaki
    TLDR: Want to check if cookie exists, if it doesn't create it. Am using jquery1.4.2 and jquery cookie, I know this is probably very simple but I just cant get my head right at the moment. I want to: Check to see if a cookie with name of "query" exists If so nothing. If not create a cookie "query" with a value of 1. But only if it doesn't already exist. Thanks in advance

    Read the article

  • ASP.net file operations delay

    - by mtranda
    Ok, so here's the problem: I'm reading the stream from a FileUpload control, reading in chunks of n bytes and writing the array in a loop until I reach the stream's end. Now the reason I do this is because I need to check several things while the upload is still going on (rather than doing a Save(); which does the whole thing in one go). Here's the problem: when doing this from the local machine, I can see the file just fine as it's uploading and its size increases (had to add a Sleep(); clause in the loop to actually get to see the file being written). However, when I upload the file from a remote machine, I don't get to see it until the the file has completed uploading. Also, I've added another call to write the progress to a text file as the progress is going on, and I get the same thing. Local: the file updates as the upload goes on, remote: the token file only appears after the upload's done (which is somewhat useless since I need it while the upload's still happening). Is there some sort of security setting in (or ASP.net) that maybe saves files in a temporary location for remote machines as opposed to the local machine and then moves them to the specified destination? I would liken this with ASP.net displaying error messages when browsing from the local machine (even on the public hostname) as opposed to the generic compilation error page/generic exception page that is shown when browsing from a remote machine (and customErrors are not off) Any clues on this? Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • JQuery uploadify plugin not working

    - by Nitesh Panchal
    Hello, I first used primefaces FileUpload component and it didn't work. Always gave "HTTP Error". So i thought there is some bug with this component and went to plain old JQuery and tried using uploadify. But still i get the same error. I am using Container Managed Security. Is this the reason for not working properly? This is my script :- $(document).ready(function(){ $('#photoInput').uploadify({ 'script' : '/Blogger/fileUploadServlet', 'uploader' : './uploadify/uploadify.swf', 'cancelImg' : './uploadify/cancel.png', 'auto' : true }); And this is my servlet which is never executed :- package Servlets; import java.io.IOException; import java.io.PrintWriter; import java.util.Iterator; import java.util.List; import javax.servlet.ServletException; import javax.servlet.annotation.WebServlet; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import org.apache.commons.fileupload.FileItemFactory; import org.apache.commons.fileupload.FileUploadException; import org.apache.commons.fileupload.disk.DiskFileItemFactory; import org.apache.commons.fileupload.servlet.ServletFileUpload; @WebServlet(name = "fileUploadServlet", urlPatterns = {"/fileUploadServlet"}) public class fileUploadServlet extends HttpServlet { protected void processRequest(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException, FileUploadException { PrintWriter out = response.getWriter(); try { System.out.println("Executed!!"); boolean isMultipart = ServletFileUpload.isMultipartContent(request); // Create a factory for disk-based file items FileItemFactory factory = new DiskFileItemFactory(); // Create a new file upload handler ServletFileUpload upload = new ServletFileUpload(factory); // Parse the request List /* FileItem */ items = upload.parseRequest(request); Iterator e = items.iterator(); while(e.hasNext()){ System.out.println(e.next().toString()); } } finally { out.close(); } } } }); Please help me. I am stuck on this since 3 hours.

    Read the article

  • Multiple accordion panes open

    - by Kevin
    We are using a jquery accordion on our site : http://www.racedayworld.com It basically lists events under each month... Apparently people are finding difficulties knowing how it really works and they don't see at first glance that there are more events under each month (that you click to expand) So I was thinking about opening two at a time (the current month and the next) .. but I'm not sure how to enable both to be open at once ... any ideas?

    Read the article

  • Show/Hide button (text) for Accordion

    - by Kevin
    Have an accordion with a "view" button to open close the accordion panel (using jQuery Tools), but I would like to have dynamic text that says "show/hide" depending on the state... Here is the code for the accordion in asp.NET <div id="accordion"> <% foreach (var eventModel in ViewModel) { %> <% var isNewMonth = eventModel.Date.Month != previousMonth; %> <% if (isNewMonth && previousMonth > 0) { %></table></div><% } %> <% previousMonth = eventModel.Date.Month; %> <% if (isNewMonth) { %> <h2><%= string.Concat(eventModel.Date.ToString("MMMM"), " ", eventModel.Date.Year) %> <span style="float:right;"><a href="#" class="button blue small">View</a></span></h2> <div class="pane" style="display:block"> <table id="listTable" width="100%" cellpadding="3" cellspacing="0" border="0"> <tr align="left" valign="top"><th align="left" valign="top">Date</th><th align="left" valign="top">Event</th><th align="left" valign="top">Event Type</th></tr> <% } %> <tr align="left" valign="top"><td align="left" valign="top"><b><span id="date" style="float:left;"> <%= string.Concat(eventModel.Date.ToString("MMMM"), " ", eventModel.Date.Day, " </span><span id='day' style='float:left'>" + eventModel.Date.DayOfWeek + "</span> ")%></b></td><td align="left" valign="top" ><%= Html.ActionLink(eventModel.Name.Truncate(40), "event", "register", new { id = eventModel.Id }, null)%></td><td align="left" valign="top"><%= string.Concat(" ", eventModel.Sport)%></td></tr> <% } %> <% if (ViewModel.Count > 0) { %></table></div><% } %> </div> Here is the initialization script using jQuery: $(function() { $("#accordion").tabs("#accordion div.pane", {tabs: 'h2', effect: 'slide', initialIndex: 0}); $(".small").click(function() { moveToTop(); }); });

    Read the article

  • How to tell when an HTML textarea has been changed by Javascript

    - by at
    A widget I'm using modifies an HTML textarea element. I need to know when that element has been modified and preferably I'd like to actually hide that element as well. I'm using jQuery, so I naturally tried the $('#textarea_id').change() event. But it's never triggered because I guess the textarea never loses focus. What's the best way to monitor that textarea, preferably hidden (css has display:none)? Please don't tell me setInterval...

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Web based weekly planner

    - by Calum
    Hello I'm looking to implement a web based weekly planner where a user can set when they will be unavailable to work. The state of the week will be saved as a 'varbinary' with a length of 168 which will represent every hour of everyday of a week. The database only needs to store the value of one week as the times unavailable to work will be the same each week. I'm looking for a quick and effective method, possibly based on jquery. Thanks

    Read the article

  • Display the info window of a Google map marker

    - by Keyslinger
    I have succeeded in loading a Google map using the gMap jQuery plugin and making it display several markers passed to it in a JSON object using the pattern demonstrated here under "Map with marker and info window". So far, so good. Now I want to have a link on the same page which, when clicked, displays the info window for a marker on the map. How is this done?

    Read the article

  • Collpasible menu needs all header needs to be closed on initial loading

    - by Maju
    I have a sidebar with collapsible menu it works fine but all the values come expanded the initial loading time.I want it to be closed on load and toggled thereafter. Here is the jquery used // Sidebar Toggle var fluid = { Toggle : function(){ var default_hide = {"grid": true }; $.each( ["pagesnav", "commentsnav", "userssnav", "imagesnav"], function() { var el = $("#" + (this == 'accordon' ? 'accordion-block' : this) ); if (default_hide[this]) { el.hide(); $("[id='toggle-"+this+"']").addClass("hidden"); } $("[id='toggle-"+this+"']") .bind("click", function(e) { if ($(this).hasClass('hidden')){ $(this).removeClass('hidden').addClass('visible'); el.slideDown(); } else { $(this).removeClass('visible').addClass('hidden'); el.slideUp(); } e.preventDefault(); }); } ); } } jQuery(function ($) { if($("[id^='toggle']").length){fluid.Toggle();} }); here is the html <span class="ul-header"><a id="toggle-pagesnav" href="#" class="toggle visible">Content</a></span> <ul id="pagesnav"> <li><a class="icn_manage_pages" href="#">Manage Pages</a></li> <li><a class="icn_add_pages" href="#">Add Pages</a></li> <li><a class="icn_edit_pages" href="#">Edit Pages</a></li> <li><a class="icn_delete_pages" href="#">Delete Pages</a></li> </ul> <!-- End Content Nav --> <!-- Start Comments Nav --> <span class="ul-header"><a id="toggle-commentsnav" href="#" class="toggle visible">Comments</a></span> <ul id="commentsnav"> <li><a class="icn_manage_comments" href="#">Manage Comments</a></li> <li><a class="icn_add_comments" href="#">Add Comments</a></li> <li><a class="icn_edit_comments" href="#">Edit Comments</a></li> <li><a class="icn_delete_comments" href="#">Delete Comments</a></li> </ul> here is the css used .toggle { display:block; } .ul-header a.visible { background:url('../img/icons/small/toggle_close.png') no-repeat scroll 97% 50%; } .ul-header a.hidden { background:url('../img/icons/small/toggle_open.png') no-repeat scroll 97% 50%; } Please help.

    Read the article

  • What is this effect called? 'Grow/shrink'? 'Fly-out/fly-in'? ...

    - by Majid
    Hi all, I have seen links that open modal windows AND have a nice animation effect that create the illusion that the window grows out of the link clicked. On closing the window a similar animation shows that the window shrinks and disappears in the link which originally opened it. I remember I saw it on some jquery page but don't remember where and don't know what this effect is called. Have you seen this? Examples?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Facebook/Youtube Like Multiple Items Select

    - by bradenkeith
    Before we continue: It can't be a predefined list. I need it sort of like this: http://loopj.com/tokeninput/demo.html ... A jQuery plugin that allows the user to type a string of words, press enter, and it makes it a block of text, from there they can press the X to get rid of it, or type more key words into the input area. I've found many things that do this, but all are pulling information from a predefined list of choices.

    Read the article

  • PHP: How to get creation date from uploaded file?

    - by Haemp
    Problem: I want to determine the original file creation time from a file uploaded to my server via PHP. My understanding is that the file is copied from the client to a temporary file on my server, which then is referenced in the $_FILES var. The temporary file is of course of no use because it was just created. Is there any way I could get the creation date from the clients original file? Thanks

    Read the article

< Previous Page | 146 147 148 149 150 151 152 153 154 155 156 157  | Next Page >