Search Results

Search found 258848 results on 10354 pages for 'text overflow'.

Page 151/10354 | < Previous Page | 147 148 149 150 151 152 153 154 155 156 157 158  | Next Page >

• How to color highlight text in a black/white document easily

  - by Lateron

  I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

  Read the article

• Text template or tool for documentation of computer configurations

  - by mjustin

  I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

  Read the article

• Converting PDF portfolios to plain text (pdftotext?)

  - by Andrea

  I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

  Read the article

• Text on Cisco ASA console is garbled/missing letters

  - by Some Linux Nerd

  I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

  Read the article

• SQL Server 2008 R2 Writing To Text File

  - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz

  I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

  Read the article

• Replace special text with sed?

  - by user143822

  I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Create text file named after a cell containing other cell data

  - by user143041

  I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

  Read the article

• How to put text in same row but different column if a certain text is present in the same row?

  - by melai

  How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

  Read the article

• Why does Chrome show overlapping text?

  - by dog44wgm

  In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

  Read the article

• Format text to 5 chars from a number

  - by Wheelersg

  In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

  Read the article

• Silverlight - Adding Text to Pushpin in Bing Maps via C#

  - by Morano88

  I was able to make my silverlight Bing map accepts Mousclicks and converts them to Pushpins in C#. Now I want to show a text next to the PushPin as a description that appears when the mouse goes over the pin , I have no clue how to do that. What are the methods that enable me to do this thing? This is the C# code : public partial class MainPage : UserControl { private MapLayer m_PushpinLayer; public MainPage() { InitializeComponent(); base.Loaded += OnLoaded; } private void OnLoaded(object sender, RoutedEventArgs e) { base.Loaded -= OnLoaded; m_PushpinLayer = new MapLayer(); x_Map.Children.Add(m_PushpinLayer); x_Map.MouseClick += OnMouseClick; } private void AddPushpin(double latitude, double longitude) { Pushpin pushpin = new Pushpin(); pushpin.MouseEnter += OnMouseEnter; pushpin.MouseLeave += OnMouseLeave; m_PushpinLayer.AddChild(pushpin, new Location(latitude, longitude), PositionOrigin.BottomCenter); } private void OnMouseClick(object sender, MapMouseEventArgs e) { Point clickLocation = e.ViewportPoint; Location location = x_Map.ViewportPointToLocation(clickLocation); AddPushpin(location.Latitude, location.Longitude); } private void OnMouseLeave(object sender, MouseEventArgs e) { Pushpin pushpin = sender as Pushpin; // remove the pushpin transform when mouse leaves pushpin.RenderTransform = null; } private void OnMouseEnter(object sender, MouseEventArgs e) { Pushpin pushpin = sender as Pushpin; // scaling will shrink (less than 1) or enlarge (greater than 1) source element ScaleTransform st = new ScaleTransform(); st.ScaleX = 1.4; st.ScaleY = 1.4; // set center of scaling to center of pushpin st.CenterX = (pushpin as FrameworkElement).Height / 2; st.CenterY = (pushpin as FrameworkElement).Height / 2; pushpin.RenderTransform = st; } }

  Read the article

• Sitecore not resolving rich text editor URLS in page renders

  - by adam

  Hi We're having issues inserting links into rich text in Sitecore 6.1.0. When a link to a sitecore item is inserted, it is outputted as: http://domain/~/link.aspx?_id=8A035DC067A64E2CBBE2662F6DB53BC5&_z=z Rather than the actual resolved url: http://domain/path/to/page.aspx This article confirms that this should be resolved in the render pipeline: in Sitecore 6 it inserts a specially formatted link that contains the Guid of the item you want to link to, then when the item is rendered the special link is replaced with the actual link to the item The pipeline has the method ShortenLinks added in web.config <convertToRuntimeHtml> <processor type="Sitecore.Pipelines.ConvertToRuntimeHtml.PrepareHtml, Sitecore.Kernel"/> <processor type="Sitecore.Pipelines.ConvertToRuntimeHtml.ShortenLinks, Sitecore.Kernel"/> <processor type="Sitecore.Pipelines.ConvertToRuntimeHtml.SetImageSizes, Sitecore.Kernel"/> <processor type="Sitecore.Pipelines.ConvertToRuntimeHtml.ConvertWebControls, Sitecore.Kernel"/> <processor type="Sitecore.Pipelines.ConvertToRuntimeHtml.FixBullets, Sitecore.Kernel"/> <processor type="Sitecore.Pipelines.ConvertToRuntimeHtml.FinalizeHtml, Sitecore.Kernel"/> </convertToRuntimeHtml> So I really can't see why links are still rendering in ID format rather than as full SEO-tastic urls. Anyone got any clues? Thanks, Adam

  Read the article

• Create Text File Without BOM

  - by balexandre

  Hi guys, I tried this aproach without any success the code I'm using: // File name String filename = String.Format("{0:ddMMyyHHmm}", dtFileCreated); String filePath = Path.Combine(Server.MapPath("App_Data"), filename + ".txt"); // Process ProcessPBS pbs = new ProcessPBS(); pbs.CreatePBSInfoFile(pbslist, Convert.ToInt64(filename)); // Save file Encoding utf8WithoutBom = new UTF8Encoding(true); TextWriter tw = new StreamWriter(filePath, false, utf8WithoutBom); foreach (string s in pbs.GeneratedFile.ToArray()) tw.WriteLine(s); tw.Close(); // Push Generated File into Client Response.Clear(); Response.ContentType = "application/vnd.text"; Response.AppendHeader("Content-Disposition", "attachment; filename=" + filename + ".txt"); Response.TransmitFile(filePath); Response.End(); the result: It's writing the BOM no matter what, and special chars (like Æ Ø Å) are not correct :-/ I'm stuck! I can't create a file using UTF-8 as Encoding and 8859-1 as CharSet :-( Anyone can help me find the light in the tunnel? All help is greatly appreciated, thank you!

  Read the article

• Calculating skew of text OpenCV

  - by Nick

  I am trying to calculate the skew of text in an image so I can correct it for the best OCR results. Currently this is the function I am using: double compute_skew(Mat &img) { // Binarize cv::threshold(img, img, 225, 255, cv::THRESH_BINARY); // Invert colors cv::bitwise_not(img, img); cv::Mat element = cv::getStructuringElement(cv::MORPH_RECT, cv::Size(5, 3)); cv::erode(img, img, element); std::vector<cv::Point> points; cv::Mat_<uchar>::iterator it = img.begin<uchar>(); cv::Mat_<uchar>::iterator end = img.end<uchar>(); for (; it != end; ++it) if (*it) points.push_back(it.pos()); cv::RotatedRect box = cv::minAreaRect(cv::Mat(points)); double angle = box.angle; if (angle < -45.) angle += 90.; cv::Point2f vertices[4]; box.points(vertices); for(int i = 0; i < 4; ++i) cv::line(img, vertices[i], vertices[(i + 1) % 4], cv::Scalar(255, 0, 0), 1, CV_AA); return angle; } When I look at then angle in debug I get 0.000000 However when I give it this image I get proper results of a skew of about 16 degrees: How can I properly detect the skew in the first image?

  Read the article

• MVC/HTML - input submit won't trigger when HTML is in a text area

  - by cw

  Any idea why the below code doesn't trigger if I were to put some HTML inside the textarea? It works fine it I don't have HTML in it, but I'm not sure why it doesn't work with it. Here is the code. <form action="/Home/AddPost" method="post"> <table> <tr> <td>Post Title:</td> <td><input id="Title" type="text" name="title" /></td> </tr> <tr> <td>Post Description:</td> <td><textarea id="Description" rows="10" cols="60" name="description"></textarea></td> </tr> </table> <input type="submit" value="Save" /> </form>

  Read the article

• how to pass password text while calling java-cxf webservice from php

  - by Darpan Desai

  hi, i have developed my webservice in java-cxf which returns java.util.List. This webservice is password enabled. that means i have used org.apache.cxf.ws.security.wss4j.WSS4JInInterceptor for security purpose. Now i want to call this webservice from php. but i am not able to do so. Without security settings i am able to access my webservice using nusoap. but when i enabled security feture (interceptor) in webservice, i am getting error like ns1:InvalidSecurity An error was discovered processing the header and i am getting response as follows: HTTP/1.1 500 Internal Server Error Server: Apache-Coyote/1.1 Content-Type: text/xml;charset=ISO-8859-1 Content-Length: 361 Date: Fri, 18 Jun 2010 08:53:54 GMT Connection: close < soap:Envelope xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/"< soap:Body< soap:Fault< faultcode xmlns:ns1="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd" ns1:InvalidSecurity< /faultcode< faultstringAn error was discovered processing the <wsse:Security header< /faultstring< /soap:Fault< /soap:Body any help will be appriciated thanks in advance Darpan Desai

  Read the article

• Android/Java -- Post simple text to Facebook wall?

  - by borg17of20

  Hello all, I'm trying to integrate posting to one's wall from within my app. I already have an area where the user can save his/her username and password (encrypted). I would like my program to recall the saved username and password, pass that to Facebook for authentication, and then allow the app to post simple text (maybe a link too) to the user's wall. That said, I've read everything on the developer pages at Facebook (the api looks completely foreign to me... I've never don't any type of web app development before... just desktop apps), and experimented with the Java libraries here: http://wiki.developers.facebook.com/index.php/User:Java but to be honest, I don't understand any of the various implementations. Some claim to be simple to use, but apparently they are all way above my head. I've even tried messing with the official Facebook Android SDK, but that uses a webview interface, and I can't pass in the username and password for easy authentication. Plus, I'm still clueless as to how to post to the wall even after correct authentication. Please help. Thanks. Oh, btw I already have a Facebook API key and Application ID.

  Read the article

• Export the datagrid data to text in asp.net

  - by SRIRAM

  Problem:It will asks there is no assembly reference/namespace for Database Database db = DatabaseFactory.CreateDatabase(); DBCommandWrapper selectCommandWrapper = db.GetStoredProcCommandWrapper("sp_GetLatestArticles"); DataSet ds = db.ExecuteDataSet(selectCommandWrapper); StringBuilder str = new StringBuilder(); for(int i=0;i<=ds.Tables[0].Rows.Count - 1; i++) { for(int j=0;j<=ds.Tables[0].Columns.Count - 1; j++) { str.Append(ds.Tables[0].Rows[i][j].ToString()); } str.Append("<BR>"); } Response.Clear(); Response.AddHeader("content-disposition", "attachment;filename=FileName.txt"); Response.Charset = ""; Response.Cache.SetCacheability(HttpCacheability.NoCache); Response.ContentType = "application/vnd.text"; System.IO.StringWriter stringWrite = new System.IO.StringWriter(); System.Web.UI.HtmlTextWriter htmlWrite = new HtmlTextWriter(stringWrite); Response.Write(str.ToString()); Response.End();

  Read the article

• Simple Android Binary Text Clock

  - by Hristo

  Hello, I want to create a simple android binary clock but my application crashes. I use 6 textview fields: 3 for the decimal and 3 for the binary representation of the current time (HH:mm:ss). Here's the code: import java.text.SimpleDateFormat; import java.util.Calendar; import android.app.Activity; import android.os.Bundle; import android.widget.TextView; public class Binary extends Activity implements Runnable { Thread runner; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); if (runner == null) { //start the song runner = new Thread(this); runner.start(); } } @Override public void run() { TextView hours_dec = (TextView) findViewById(R.id.hours_dec); TextView mins_dec = (TextView) findViewById(R.id.mins_dec); TextView secs_dec = (TextView) findViewById(R.id.secs_dec); TextView hours_bin = (TextView) findViewById(R.id.hours_bin); TextView mins_bin = (TextView) findViewById(R.id.mins_bin); TextView secs_bin = (TextView) findViewById(R.id.secs_bin); SimpleDateFormat hours_sdf = new SimpleDateFormat("HH"); SimpleDateFormat mins_sdf = new SimpleDateFormat("mm"); SimpleDateFormat secs_sdf = new SimpleDateFormat("ss"); Calendar cal = Calendar.getInstance(); while (runner != null) { WaitAMoment(); cal.getTime(); hours_dec.setText(hours_sdf.format(cal.getTime())); mins_dec.setText(mins_sdf.format(cal.getTime())); secs_dec.setText(secs_sdf.format(cal.getTime())); hours_bin.setText(String.valueOf(Integer.toBinaryString(Integer.parseInt((String) hours_dec.getText())))); mins_bin.setText(String.valueOf(Integer.toBinaryString(Integer.parseInt((String) mins_dec.getText())))); secs_bin.setText(String.valueOf(Integer.toBinaryString(Integer.parseInt((String) secs_dec.getText())))); } } protected void WaitAMoment() { try { Thread.sleep(100); } catch (InterruptedException e) { }; } }`

  Read the article

• How to pass password text while calling Java CXF webservice from PHP

  - by Darpan Desai

  I have developed my webservice in Java CXF which returns java.util.List. This webservice is password enabled. that means i have used org.apache.cxf.ws.security.wss4j.WSS4JInInterceptor for security purpose. Now i want to call this webservice from php. but i am not able to do so. Without security settings i am able to access my webservice using nusoap. but when i enabled security feture (interceptor) in webservice, i am getting error like ns1:InvalidSecurity An error was discovered processing the header and i am getting response as follows: HTTP/1.1 500 Internal Server Error Server: Apache-Coyote/1.1 Content-Type: text/xml;charset=ISO-8859-1 Content-Length: 361 Date: Fri, 18 Jun 2010 08:53:54 GMT Connection: close < soap:Envelope xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/"< soap:Body< soap:Fault< faultcode xmlns:ns1="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd" ns1:InvalidSecurity< /faultcode< faultstringAn error was discovered processing the <wsse:Security header< /faultstring< /soap:Fault< /soap:Body any help will be appriciated thanks in advance Darpan Desai

  Read the article

• sqlite3 update text in uitextview

  - by summer

  i had the sqlite statement ready for update..but i am confuse about grabbing text from uitextview and updating it..and i waned to update it using a uibutton..how do i carry on after creating the sql statement???kinda lost..any new solution is appreciate.. - (void) saveAllData { if(isDirty) { if(updateStmt == nil) { const char *sql = "update Snap Set snapTitle = ?, snapDesc = ?, Where snapID = ?"; if(sqlite3_prepare_v2(database, sql, -1, &updateStmt, NULL) != SQLITE_OK) NSAssert1(0, @"Error while creating update statement. '%s'", sqlite3_errmsg(database)); } sqlite3_bind_text(updateStmt, 1, [snapTitle UTF8String], -1, SQLITE_TRANSIENT); sqlite3_bind_text(updateStmt, 2, [snapDescription UTF8String], -2, SQLITE_TRANSIENT); sqlite3_bind_int(updateStmt, 3, snapID); if(SQLITE_DONE != sqlite3_step(updateStmt)) NSAssert1(0, @"Error while updating. '%s'", sqlite3_errmsg(database)); sqlite3_reset(updateStmt); isDirty = NO; } //Reclaim all memory here. [snapTitle release]; snapTitle = nil; [snapDescription release]; snapDescription = nil; //isDetailViewHydrated = NO; }

  Read the article

• Tagging translated text correctly (tagging with lang="")

  - by toomanyairmiles

  A client has asked me to add some polish text to their website, not having much experience in this area, can anyone tell me which of the two 'lang' solutions below is correct (or offer an alternative):- Tag everything:- <div lang="pl"> <h2 lang="pl">Najlepszy ruch jaki zrobisz!</h2> <p lang="pl">Do przyszlych najemców:</p> <p lang="pl">Tutaj w SPS mamy bogate doswiadczenie na rynku najmu i wyszukiwaniu domu, który bedzie idealnym miejscem dla przyszlych lokatorów. Dla wielu moze to byc trudne i stresujace, dlatego my w SPS pomozemy Wam przejsc przez pole minowe zwiazane z najmem i uczynic ten proces najprostszym i najszybszym jak to mozliwe.</p> <p lang="pl">Jesli szukasz nieruchomosci obecnie lub w najblizszej przyszlosci prosimy o kontakt z naszym doswiadczonym , przyjaznym i pomocnym personelem, a my postaramy sie pomóc znalezc Ci idealne miejsce, które jest wlasnie dla Ciebie.</p> <p lang="pl">Wiec aby w latwy sposób wynajac zadzwon juz dzis.</p> </div> Just tag the div <div lang="pl"> <h2>Najlepszy ruch jaki zrobisz!</h2> <p>Do przyszlych najemców:</p> <p>Tutaj w SPS mamy bogate doswiadczenie na rynku najmu i wyszukiwaniu domu, który bedzie idealnym miejscem dla przyszlych lokatorów. Dla wielu moze to byc trudne i stresujace, dlatego my w SPS pomozemy Wam przejsc przez pole minowe zwiazane z najmem i uczynic ten proces najprostszym i najszybszym jak to mozliwe.</p> <p>Jesli szukasz nieruchomosci obecnie lub w najblizszej przyszlosci prosimy o kontakt z naszym doswiadczonym , przyjaznym i pomocnym personelem, a my postaramy sie pomóc znalezc Ci idealne miejsce, które jest wlasnie dla Ciebie.</p> <p>Wiec aby w latwy sposób wynajac zadzwon juz dzis.</p> </div>

  Read the article

• XPATH query, HtmlAgilityPack and Extracting Text

  - by Soham

  I had been trying to extract links from a class called "tim_new" . I have been given a solution as well. Both the solution, snippet and necessary information is given here The said XPATH query was "//a[@class='tim_new'], my question is, how did this query differentiate between the first line of the snippet (given in the link above and the second line of the snippet). More specifically, what is the literal translation (in English) of this XPATH query. Furthermore, I want to write a few lines of code to extract the text written against NSE: <div class="FL gL_12 PL10 PT15">BSE: 523395 &nbsp;&nbsp;|&nbsp;&nbsp; NSE: 3MINDIA &nbsp;&nbsp;|&nbsp;&nbsp; ISIN: INE470A01017</div> Would appreciate help in forming the necessary selection query. My code is written as: IEnumerable<string> NSECODE = doc.DocumentNode.SelectSingleNode("//div[@NSE:]"); But this doesnt look right. Would appreciate some help.

  Read the article

• Delphi: Alternative to using Assign/ReadLn for text file reading

  - by Ian Boyd

  i want to process a text file line by line. In the olden days i loaded the file into a StringList: slFile := TStringList.Create(); slFile.LoadFromFile(filename); for i := 0 to slFile.Count-1 do begin oneLine := slFile.Strings[i]; //process the line end; Problem with that is once the file gets to be a few hundred megabytes, i have to allocate a huge chunk of memory; when really i only need enough memory to hold one line at a time. (Plus, you can't really indicate progress when you the system is locked up loading the file in step 1). The i tried using the native, and recommended, file I/O routines provided by Delphi: var f: TextFile; begin Assign(filename, f); while ReadLn(f, oneLine) do begin //process the line end; Problem withAssign is that there is no option to read the file without locking (i.e. fmShareDenyNone). The former stringlist example doesn't support no-lock either, unless you change it to LoadFromStream: slFile := TStringList.Create; stream := TFileStream.Create(filename, fmOpenRead or fmShareDenyNone); slFile.LoadFromStream(stream); stream.Free; for i := 0 to slFile.Count-1 do begin oneLine := slFile.Strings[i]; //process the line end; So now even though i've gained no locks being held, i'm back to loading the entire file into memory. Is there some alternative to Assign/ReadLn, where i can read a file line-by-line, without taking a sharing lock? i'd rather not get directly into Win32 CreateFile/ReadFile, and having to deal with allocating buffers and detecting CR, LF, CRLF's. i thought about memory mapped files, but there's the difficulty if the entire file doesn't fit (map) into virtual memory, and having to maps views (pieces) of the file at a time. Starts to get ugly. i just want Assign with fmShareDenyNone!

  Read the article

< Previous Page | 147 148 149 150 151 152 153 154 155 156 157 158  | Next Page >