Search Results

Search found 8800 results on 352 pages for 'import'.

Page 152/352 | < Previous Page | 148 149 150 151 152 153 154 155 156 157 158 159  | Next Page >

  • Help with pyHook error.

    - by Shady
    Hey, I'm trying to make a global hotkey with pyhook in python that is supposed to work only with the alt key pressed. here is the source: import pyHook import pythoncom hm = pyHook.HookManager() def OnKeyboardEvent(event): if event.Alt == 32 and event.KeyID == 49: print 'HERE WILL BE THE CODE' hm.KeyDown = OnKeyboardEvent hm.HookKeyboard() pythoncom.PumpMessages() but when I execute, only works with the second press of the second key (number 1 = 49)... and give this error: http://img580.imageshack.us/img580/1858/errord.png How can I solve it? For work at the first pressed time.

    Read the article

  • PHP: Coding long-running scripts when servers impose an execution time limit

    - by thomasrutter
    FastCGI servers, for example, impose an execution time limit on PHP scripts which cannot be altered using set_time_limit() in PHP. IIS does this too I believe. I wrote an import script for a PHP application that works well under mod_php but fails under FastCGI (mod_fcgid) because the script is killed after a certain number of seconds. I don't yet know of a way of detecting what your time limit is in this case, and haven't decided how I'm going to get around it. Doing it in small chunks with redirects seems like one kludge, but how? What techniques would you use when coding a long-running task such as an import or export task, where an individual PHP script may be terminated by the server after a certain number of seconds? Please assume you're creating a portable script, so you don't necessarily know whether PHP will eventually be run under mod_php, FastCGI or IIS or whether a maximum execution time is enforced at the server level.

    Read the article

  • org.apache.http.impl.cookie.BasicClientCookie not serializable???

    - by Misha Koshelev
    Dear All: I am quite confused... I am reading here and BasicClientCookie clearly implements Serializable per JavaDoc: http://hc.apache.org/httpcomponents-client/httpclient/apidocs/org/apache/http/impl/cookie/BasicClientCookie.html However, my simple Groovy script: #!/usr/bin/env groovy @Grapes( @Grab(group='org.apache.httpcomponents', module='httpclient', version='4.0.1') ) import org.apache.http.impl.cookie.BasicClientCookie import java.io.File def cookie=new BasicClientCookie("name","value") println cookie instanceof Serializable def f=new File("/tmp/test") f.withObjectOutputStream() { oos-> oos.writeObject(cookie) } outputs: false Caught: java.io.NotSerializableException: org.apache.http.impl.cookie.BasicClientCookie at t$_run_closure1.doCall(t.groovy:12) at t.run(t.groovy:11) I have checked and I have no other versions of HttpClient anywhere in classpath (if I take Grapes statement out it cannot find file). Thank you! Misha Koshelev

    Read the article

  • dreamweaver sites

    - by ngreenwood6
    Hello, We have over 500 sites that we host. All of there ftp information is in a database. Whenever one of our programmers have to add a site they have to get all the info and set it up. However, I found that you can export them and it has all the info except for one problem. The password is encrypted. I am not trying to hack anything, I want to know how to encrypt our passwords so that we can import them using dreamweavers import feature. Can anyone tell me what encryption they use or a link on how to encrypt. I am not interested in decrypting at all because we already have all of them so it would not do me any good. Thanks for any help

    Read the article

  • Error when trying to use hibernate annotations.

    - by Wilhelm
    The error I'm receiving is listed here. That's my HibernateUtil.java package com.rosejapan; import org.hibernate.SessionFactory; import org.hibernate.cfg.AnnotationConfiguration;; public class HibernateUtil { private static final SessionFactory sessionFactory; static { try { // Create the SessionFactory from hibernate.cfg.xml sessionFactory = new AnnotationConfiguration().configure().buildSessionFactory(); } catch(Throwable e) { System.err.println("Initial sessionFactory creation failed. " + e); throw new ExceptionInInitializerError(e); } } public static SessionFactory getSessionFactory() { return sessionFactory; } } Everything looks all right... I've already included log4j-boot.jar in the CLASSPATH, but didn't resolved my problem.

    Read the article

  • Silence output from SimpleXMLRPCServer

    - by Corey Goldberg
    I am running an xml-rpc server using SimpleXMLRPCServer from the stdlib. My code looks something like this: import SimpleXMLRPCServer import socket class RemoteStarter: def start(self): return 'foo' rs = RemoteStarter() host = socket.gethostbyaddr(socket.gethostname())[0] port = 9000 server = SimpleXMLRPCServer.SimpleXMLRPCServer((host, port)) server.register_instance(rs) server.serve_forever() every time the 'start' method gets called remotely, the server prints an access line like this: <server_name> - - [10/Mar/2010 13:06:20] "POST /RPC2 HTTP/1.0" 200 - I can't figure out a way to silence the output so it doesn't print these access lines to stdout. anyone?

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • Java Web Service Client from Microsoft Live Search

    - by trendyy
    I generated java web service from here -- http://api.search.live.net/search.wsdl.. I want to make search and listing the return values. In my opinion i generated client and client is makes research but i can't display result, how i can do that.. Can anyone check my wrote code and help me about displaying result? Thanks... import java.rmi.RemoteException; import com.microsoft.schemas.LiveSearch._2008._03.Search.*; public class searchtry { public static void main(String[] args) throws RemoteException { LiveSearchPortTypeProxy client=new LiveSearchPortTypeProxy(); SearchRequest request=new SearchRequest(); SearchRequestType1 type1=new SearchRequestType1(); sorgu.setAppId("*********************************"); //Windows Live gave this id for using that service sorgu.setSources(new SourceType[]{SourceType.Web}); sorgu.setQuery("Java"); aratip.setParameters(request); SearchResponseType0 answer= client.search(type1); System.out.println(answer.toString()); }

    Read the article

  • Sending mail from Python using SMTP

    - by Eli Bendersky
    I'm using the following method to send mail from Python using SMTP. Is it the right method to use or are there gotchas I'm missing ? from smtplib import SMTP import datetime debuglevel = 0 smtp = SMTP() smtp.set_debuglevel(debuglevel) smtp.connect('YOUR.MAIL.SERVER', 26) smtp.login('USERNAME@DOMAIN', 'PASSWORD') from_addr = "John Doe <[email protected]>" to_addr = "[email protected]" subj = "hello" date = datetime.datetime.now().strftime( "%d/%m/%Y %H:%M" ) message_text = "Hello\nThis is a mail from your server\n\nBye\n" msg = "From: %s\nTo: %s\nSubject: %s\nDate: %s\n\n%s" % ( from_addr, to_addr, subj, date, message_text ) smtp.sendmail(from_addr, to_addr, msg) smtp.quit()

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • load a pickle file from a zipfile

    - by eric.frederich
    For some reason I cannot get cPickle.load to work on the file-type object returned by ZipFile.open(). If I call read() on the file-type object returned by ZipFile.open() I can use cPickle.loads though. Example .... import zipfile import cPickle # the data we want to store some_data = {1: 'one', 2: 'two', 3: 'three'} # # create a zipped pickle file # zf = zipfile.ZipFile('zipped_pickle.zip', 'w', zipfile.ZIP_DEFLATED) zf.writestr('data.pkl', cPickle.dumps(some_data)) zf.close() # # cPickle.loads works # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd1 = cPickle.loads(zf.open('data.pkl').read()) zf.close() # # cPickle.load doesn't work # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd2 = cPickle.load(zf.open('data.pkl')) zf.close() Note: I don't want to zip just the pickle file but many files of other types. This is just an example.

    Read the article

  • How to organize asp.net mvc project (using entity framework) and a corresponding database project?

    - by Bernie
    I recently switched to vs2010 and am experimenting with asp.net MVC2. I am building a simple website and use the entity framework to design the data model. From the .edmx file, I generate the database tables. After a few iterations, I decided that it would be nice to have version control of the database schema as well, and therefore I added a database project into which I imported the script that is generated from the datamodel. As a result, I have to generate the sql every time that I change the model and redo the import. The database project automatically updates the database. Although the manual steps to generate the sql and the import are annoying, this works pretty well, until I wanted to add the standard tables for user accounts/authorization etc. I can use the framework tools to add the necessary tables, views etc. to the database, but as I do not want to have them in the .edmx model I end up with a third manual step. Is anybody facing similar issues?

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • Looking for Reachability (2.0) Use Case Validation

    - by user350243
    There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • multiline gtk.Label ignores xalign=0.5

    - by thomas
    A gtk.Label can't be aligned in center when line-wrap is turned on. Example code: import pygtk pygtk.require('2.0') import gtk class testwin(gtk.Window): def __init__(self): gtk.Window.__init__(self) width,height = 300,300 self.set_size_request(width,height) self.set_position(gtk.WIN_POS_CENTER) self.set_title("test window") label = gtk.Label("test text") label.set_line_wrap(True) label.set_justify(gtk.JUSTIFY_CENTER) label.set_alignment(0.5,0.5) label.connect("size-allocate",lambda l,s: l.set_size_request(s.width-1, -1)) self.add(label) self.connect("destroy", gtk.main_quit) self.show_all() testwin() gtk.main() It looks like this, that means, it's aligned left: http://m45.img-up.net/?up=pic122x97.png If you comment out line 14 (set_line_wrap) everything is perfectly fine: http://o54.img-up.net/?up=pic2y00p9.png Please note that yalign works fine. So it seems like the first argument in the gtk.Misc.set_alignment-function has no effect when line wrap is turned on. Using Fedora 16, 64bit, gtk 3.2.4, pygtk 2.24.0, python 2.7.2 Question: Is this intended or a bug? How is it supposed to be made or is a workaround available?

    Read the article

  • How do I create an OpenCV image from a PIL image?

    - by scrible
    I want to do some image processing with OpenCV (in Python), but I have to start with a PIL Image object, so I can't use the cvLoadImage() call, since that takes a filename. This recipe (adapted from http://opencv.willowgarage.com/wiki/PythonInterface) does not work because cvSetData complains argument 2 of type 'void *' . Any ideas? from opencv.cv import * from PIL import Image pi = Image.open('foo.png') # PIL image ci = cvCreateImage(pi.size, IPL_DEPTH_8U, 1) # OpenCV image data = pi.tostring() cvSetData(ci, data, len(data)) I think the last argument to the cvSetData is wrong too, but I am not sure what it should be.

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • Cannot instantiate abstract class or interface : problem while persisting

    - by sammy
    i have a class campaign that maintains a list of AdGroupInterfaces. im going to persist its implementation @Entity @Table(name = "campaigns") public class Campaign implements Serializable,Comparable<Object>,CampaignInterface { private static final long serialVersionUID = 1L; @Id @GeneratedValue(strategy = GenerationType.IDENTITY) private Long id; @OneToMany ( cascade = {CascadeType.ALL}, fetch = FetchType.EAGER, targetEntity=AdGroupInterface.class ) @org.hibernate.annotations.Cascade( value = org.hibernate.annotations.CascadeType.DELETE_ORPHAN ) @org.hibernate.annotations.IndexColumn(name = "CHOICE_POSITION") private List<AdGroupInterface> AdGroup; public Campaign() { super(); } public List<AdGroupInterface> getAdGroup() { return AdGroup; } public void setAdGroup(List<AdGroupInterface> adGroup) { AdGroup = adGroup; } public void set1AdGroup(AdGroupInterface adGroup) { if(AdGroup==null) AdGroup=new LinkedList<AdGroupInterface>(); AdGroup.add(adGroup); } } AdGroupInterface's implementation is AdGroups. when i add an adgroup to the list in campaign, campaign c; c.getAdGroupList().add(new AdGroups()), etc and save campaign it says"Cannot instantiate abstract class or interface :" AdGroupInterface its not recognizing the implementation just before persisting... Whereas Persisting adGroups separately works. when it is a member of another entity, it doesnt get persisted. import java.io.Serializable; import java.util.List; import javax.persistence.*; @Entity @DiscriminatorValue("1") @Table(name = "AdGroups") public class AdGroups implements Serializable,Comparable,AdGroupInterface{ /** * */ private static final long serialVersionUID = 1L; private Long Id; private String Name; private CampaignInterface Campaign; private MonetaryValue DefaultBid; public AdGroups(){ super(); } public AdGroups( String name, CampaignInterface campaign) { super(); this.Campaign=new Campaign(); Name = name; this.Campaign = campaign; DefaultBid = defaultBid; AdList=adList; } @Id @GeneratedValue(strategy = GenerationType.IDENTITY) @Column(name="AdGroup_Id") public Long getId() { return Id; } public void setId(Long id) { Id = id; } @Column(name="AdGroup_Name") public String getName() { return Name; } public void setName(String name) { Name = name; } @ManyToOne @JoinColumn (name="Cam_ID", nullable = true,insertable = false) public CampaignInterface getCampaign() { return Campaign; } public void setCampaign(CampaignInterface campaign) { this.Campaign = campaign; } } what am i missing?? please look into it ...

    Read the article

  • Maven eclipse does not add a dependency

    - by Calm Storm
    I have the following snippet in my pom.xml <dependency> <groupId>aspectj</groupId> <artifactId>aspectjrt</artifactId> <version>1.5.3</version> </dependency> and in one of my Java files I refer a class org.aspectj.lang.ProceedingJoinPoint. When I do a "mvn clean install" it compiles and builds fine but when I do an eclipse:eclipse, and import the project in eclipse it gives me an error The import org.aspectj cannot be resolved. I checked the .classpath file that was generated and it does not have an entry to this file. I tried a "mvn dependency:tree" and it lists this fine. Can someone tell me what is going wrong here?

    Read the article

  • Relative paths in spring classpath resource

    - by Mike Q
    Hi all, I have a bunch of spring config files, all of which live under the META-INF directory in various subpackages. I have been using import like the following... <import resource="../database/schema.xml"/> So a relative path from the source file. This works fine when I am working with a local build outside of a jar file. But when I package everything up in a jar then I get an error that it cannot resolve the URL resource. If I change the above to an absolute path (with classpath:) then it works fine. Is there any way to use relative paths with ".." in when the configs are packaged in a jar or am I restricted to descending relative paths and absolute paths only? Thanks.

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • MySQLdb not INSERTING, _mysql does fine.

    - by Mad_Casual
    Okay, I log onto the MySQL command-line client as root. I then open or otherwise run a python app using the MySQLdb module as root. When I check the results using python (IDLE), everything looks fine. When I use the MySQL command-line client, no INSERT has occurred. If I change things around to _mysql instead of MySQLdb, everything works fine. I'd appreciate any clarification(s). "Works" until IDLE/Virtual machine is reset: <pre><code>import MySQLdb db = MySQLdb.connect(user='root', passwd='*******',db='test') cursor = db.cursor() cursor.execute("""INSERT INTO test VALUES ('somevalue');""",)</code></end> Works: <pre><code>import _mysql db = _mysql.connect(user='root', passwd='*******',db='test') db.query("INSERT INTO test VALUES ('somevalue');")</code></end> System info: Intel x86 WinXP Python 2.5 MySQL 5.1.41 MySQL-Python 1.2.2

    Read the article

< Previous Page | 148 149 150 151 152 153 154 155 156 157 158 159  | Next Page >