Search Results

Search found 91302 results on 3653 pages for 'code behind'.

Page 1569/3653 | < Previous Page | 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576  | Next Page >

  • Strange things appear on running the program

    - by FILIaS
    Hey! I'm fixing a program but I'm facing a problem and I cant really realize what's the wrong on the code. I would appreciate any help. I didnt post all the code...but i think with this part you can get an idea of it. With the following function enter() I wanna add user commands' datas to a list. eg. user give the command: "enter james bond 007 gun" 'james' is supposed to be the name, 'bond' the surname, 007 the amount and the rest is the description. I use strtok in order to 'cut' the command,then i put each name on a temp array. Then i call InsertSort in order to put the datas on a linked list but in alphabetical order depending on the surname that users give. I wanna keep the list on order and put each time the elements on the right position. /* struct for all the datas that user enters on file*/ typedef struct catalog { char short_name[50]; char surname[50]; signed int amount; char description[1000]; struct catalog *next; }catalog,*catalogPointer; catalogPointer current; catalogPointer head = NULL; void enter(void)//user command: enter <name> <surname> <amount> <description> { int n,j=2,k=0; char temp[1500]; char command[1500]; while (command[j]!=' ' && command[j]!='\0') { temp[k]=command[j]; j++; k++; } temp[k]='\0'; char *curToken = strtok(temp," "); printf("temp is:%s \n",temp); char short_name[50],surname[50],description[1000]; signed int amount; //short_name=(char *)malloc(sizeof (char *)); //surname=(char *)malloc(sizeof (char *)); //description=(char *)malloc(sizeof (char *)); //amount=(int *)malloc(sizeof (int *)); printf("\nWhat you entered for saving:\n"); for (n = 0; curToken !='\0'; ++n) { if (curToken) { strncpy(short_name, curToken, sizeof (char *)); / } printf("Short Name: %s \n",short_name); curToken = strtok(NULL," "); if (curToken) strncpy(surname, curToken, sizeof (char *)); / printf("SurName: %s \n",surname); curToken = strtok(NULL," "); if (curToken) { char *chk; amount = (int) strtol(curToken, &chk, 10); if (!isspace(*chk) && *chk != 0) fprintf(stderr,"Warning: expected integer value for amount, received %s instead\n",curToken); } printf("Amount: %d \n",amount); curToken = strtok(NULL,"\0"); if (curToken) { strncpy(description, curToken, sizeof (char *)); } printf("Description: %s \n",description); break; } if (findEntryExists(head, surname) != NULL) printf("\nAn entry for <%s %s> is already in the catalog!\nNew entry not entered.\n",short_name,surname); else { printf("\nTry to entry <%s %s %d %s> in the catalog list!\n",short_name,surname,amount,description); InsertSort(&head,short_name, surname, amount, description); printf("\n**Entry done!**\n"); } // Maintain the list in alphabetical order by surname. } /********Uses special case code for the head end********/ void SortedInsert(catalog** headRef, catalogPointer newNode,char short_name[],char surname[],signed int amount,char description[]) { strcpy(newNode->short_name, short_name); strcpy(newNode->surname, surname); newNode->amount=amount; strcpy(newNode->description, description); // Special case for the head end if (*headRef == NULL||(*headRef)->surname >= newNode->surname) { newNode->next = *headRef; *headRef = newNode; } else { // Locate the node before the point of insertion catalogPointer current = *headRef; catalogPointer temp=current->next; while ( temp!=NULL ) { if(strcmp(temp->surname,newNode->surname)<0 ) current = temp; } newNode->next = temp; temp = newNode; } } // Given a list, change it to be in sorted order (using SortedInsert()). void InsertSort(catalog** headRef,char short_name[],char surname[],signed int amount,char description[]) { catalogPointer result = NULL; // build the answer here catalogPointer current = *headRef; // iterate over the original list catalogPointer next; while (current!=NULL) { next = current->next; // tricky - note the next pointer before we change it SortedInsert(&result,current,short_name,surname,amount,description); current = next; } *headRef = result; } Running the program I get these strange things (garbage?)... Choose your selection: enter james bond 007 gun Your command is: enter james bond 007 gun temp is:james What you entered for saving: Short Name: james SurName: Amount: 0 Description: 0T?? Try to entry james 0 0T?? in the catalog list! Entry done! Also I'm facing a problem on how to use the 'malloc' on this program. Thanks in advance. . .

    Read the article

  • Contact Bubble EditText

    - by toobsco42
    I am trying to create contact bubbles in the MultiAutoCompleteTextView similiar to how it is implemented in the Google+ app. Below is a screen shot: . I have tried to extend the DynamicDrawableSpan class in order to get a spannable drawable in the background of a span of text public class BubbleSpan extends DynamicDrawableSpan { private Context c; public BubbleSpan(Context context) { super(); c = context; } @Override public Drawable getDrawable() { Resources res = c.getResources(); Drawable d = res.getDrawable(R.drawable.oval); d.setBounds(0, 0, 100, 20); return d; } } Where my oval.xml drawable is defined as so: <?xml version="1.0" encoding="utf-8"?> <shape xmlns:android="http://schemas.android.com/apk/res/android" android:shape="oval"> <solid android:color="#00000000"/> <stroke android:width="4dp" android:color="#99000000" android:dashWidth="4dp" android:dashGap="2dp" /> <padding android:left="7dp" android:top="7dp" android:right="7dp" android:bottom="7dp" /> <corners android:radius="4dp" /> </shape> In my Activity class that has the MulitAutoCompleteTextView, I set the bubble span like so: final Editable e = tv.getEditableText(); final SpannableStringBuilder sb = new SpannableStringBuilder(); sb.append("some sample text"); sb.setSpan(new BubbleSpan(getApplicationContext()), 0, 6, Spannable.SPAN_EXCLUSIVE_EXCLUSIVE); e.append(sb); However, instead of the oval shape displaying behind the first 6 characters in the string, the characters are not visible and there is no oval drawable in the background. If i change the BubbleSpan's getDrawable() method to use a .png instead of a shape drawable: public Drawable getDrawable() { Resources res = c.getResources(); Drawable d = res.getDrawable(android.R.drawable.bottom_bar); d.setBounds(0, 0, 100, 20); return d; } Then the .png will show up but the characters in the string that are a part of the span will not show up. How can I make it so that the characters in the span are displayed in the foreground, meanwhile a custom shape drawable gets displayed in the background? I attempted to also use an ImageSpan instead of subclassing DynamicDrawableSpan but was unsuccessful.

    Read the article

  • Hibernate + Spring : cascade deletion ignoring non-nullable constraints

    - by E.Benoît
    Hello, I seem to be having one weird problem with some Hibernate data classes. In a very specific case, deleting an object should fail due to existing, non-nullable relations - however it does not. The strangest part is that a few other classes related to the same definition behave appropriately. I'm using HSQLDB 1.8.0.10, Hibernate 3.5.0 (final) and Spring 3.0.2. The Hibernate properties are set so that batch updates are disabled. The class whose instances are being deleted is: @Entity( name = "users.Credentials" ) @Table( name = "credentials" , schema = "users" ) public class Credentials extends ModelBase { private static final long serialVersionUID = 1L; /* Some basic fields here */ /** Administrator credentials, if any */ @OneToOne( mappedBy = "credentials" , fetch = FetchType.LAZY ) public AdminCredentials adminCredentials; /** Active account data */ @OneToOne( mappedBy = "credentials" , fetch = FetchType.LAZY ) public Account activeAccount; /* Some more reverse relations here */ } (ModelBase is a class that simply declares a Long field named "id" as being automatically generated) The Account class, which is one for which constraints work, looks like this: @Entity( name = "users.Account" ) @Table( name = "accounts" , schema = "users" ) public class Account extends ModelBase { private static final long serialVersionUID = 1L; /** Credentials the account is linked to */ @OneToOne( optional = false ) @JoinColumn( name = "credentials_id" , referencedColumnName = "id" , nullable = false , updatable = false ) public Credentials credentials; /* Some more fields here */ } And here is the AdminCredentials class, for which the constraints are ignored. @Entity( name = "admin.Credentials" ) @Table( name = "admin_credentials" , schema = "admin" ) public class AdminCredentials extends ModelBase { private static final long serialVersionUID = 1L; /** Credentials linked with an administrative account */ @OneToOne( optional = false ) @JoinColumn( name = "credentials_id" , referencedColumnName = "id" , nullable = false , updatable = false ) public Credentials credentials; /* Some more fields here */ } The code that attempts to delete the Credentials instances is: try { if ( account.validationKey != null ) { this.hTemplate.delete( account.validationKey ); } this.hTemplate.delete( account.languageSetting ); this.hTemplate.delete( account ); } catch ( DataIntegrityViolationException e ) { return false; } Where hTemplate is a HibernateTemplate instance provided by Spring, its flush mode having been set to EAGER. In the conditions shown above, the deletion will fail if there is an Account instance that refers to the Credentials instance being deleted, which is the expected behaviour. However, an AdminCredentials instance will be ignored, the deletion will succeed, leaving an invalid AdminCredentials instance behind (trying to refresh that instance causes an error because the Credentials instance no longer exists). I have tried moving the AdminCredentials table from the admin DB schema to the users DB schema. Strangely enough, a deletion-related error is then triggered, but not in the deletion code - it is triggered at the next query involving the table, seemingly ignoring the flush mode setting. I've been trying to understand this for hours and I must admit I'm just as clueless now as I was then.

    Read the article

  • Session caching problem

    - by Levani
    I have a strange problem with php sessions. I use them for authorization on my site. I store two variables - currently logged in user's id and username in session. When I log in with one username, than log out and log in again with another username the previous user's id is returned using the session variable instead of the current user. The most strange thing is that this happens only when it comes to insert some data into database. When I directly echo this variable the correct id is displayed, but when I insert new record into database this variable sends incorrect id. Here is the php code I use for sending data into database: <?php session_start(); //connect database require_once 'dbc.php'; $authorID = $_SESSION['user_id']; if ( $authorID != 0 ) { $content = htmlentities($_POST["answ_content"],ENT_COMPAT,'UTF-8'); $dro = date('Y-m-d H:i:s'); $qID = $_POST["question_ID"]; $author = 'avtori'; $sql="INSERT INTO comments (comment_ID, comment_post_ID, comment_author, comment_date, comment_content, user_id) VALUES (NULL, '$qID', '$author', '$dro', '$content', '$authorID')"; $result = mysql_query($sql); } else { echo 'error'; } ?> Can anyone please help? Here is the logout function: function logout() { global $db; session_start(); if(isset($_SESSION['user_id']) || isset($_COOKIE['user_id'])) { mysql_query("update `users` set `ckey`= '', `ctime`= '' where `id`='$_SESSION[user_id]' OR `id` = '$_COOKIE[user_id]'") or die(mysql_error()); } /************ Delete the sessions****************/ unset($_SESSION['user_id']); unset($_SESSION['user_name']); unset($_SESSION['user_level']); unset($_SESSION['HTTP_USER_AGENT']); session_unset(); session_destroy(); /* Delete the cookies*******************/ setcookie("user_id", '', time()-60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_name", '', time()-60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_key", '', time()-60*60*24*COOKIE_TIME_OUT, "/"); header("Location: index.php"); } Here is the authentication script: include 'dbc.php'; $err = array(); foreach($_GET as $key => $value) { $get[$key] = filter($value); //get variables are filtered. } if ($_POST['doLogin']=='Login') { foreach($_POST as $key => $value) { $data[$key] = filter($value); // post variables are filtered } $user_email = $data['usr_email']; $pass = $data['pwd']; if (strpos($user_email,'@') === false) { $user_cond = "user_name='$user_email'"; } else { $user_cond = "user_email='$user_email'"; } $result = mysql_query("SELECT `id`,`pwd`,`full_name`,`approved`,`user_level` FROM users WHERE $user_cond AND `banned` = '0' ") or die (mysql_error()); $num = mysql_num_rows($result); // Match row found with more than 1 results - the user is authenticated. if ( $num > 0 ) { list($id,$pwd,$full_name,$approved,$user_level) = mysql_fetch_row($result); if(!$approved) { //$msg = urlencode("Account not activated. Please check your email for activation code"); $err[] = "Account not activated. Please check your email for activation code"; //header("Location: login.php?msg=$msg"); //exit(); } //check against salt if ($pwd === PwdHash($pass,substr($pwd,0,9))) { // this sets session and logs user in session_start(); session_regenerate_id (true); //prevent against session fixation attacks. // this sets variables in the session $_SESSION['user_id']= $id; $_SESSION['user_name'] = $full_name; $_SESSION['user_level'] = $user_level; $_SESSION['HTTP_USER_AGENT'] = md5($_SERVER['HTTP_USER_AGENT']); //update the timestamp and key for cookie $stamp = time(); $ckey = GenKey(); mysql_query("update users set `ctime`='$stamp', `ckey` = '$ckey' where id='$id'") or die(mysql_error()); //set a cookie if(isset($_POST['remember'])){ setcookie("user_id", $_SESSION['user_id'], time()+60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_key", sha1($ckey), time()+60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_name",$_SESSION['user_name'], time()+60*60*24*COOKIE_TIME_OUT, "/"); } if(empty($err)){ header("Location: myaccount.php"); } } else { //$msg = urlencode("Invalid Login. Please try again with correct user email and password. "); $err[] = "Invalid Login. Please try again with correct user email and password."; //header("Location: login.php?msg=$msg"); } } else { $err[] = "Error - Invalid login. No such user exists"; } }

    Read the article

  • How to make this sub-sub-query work?

    - by Josh Weissbock
    I am trying to do this in one query. I asked a similar question a few days ago but my personal requirements have changed. I have a game type website where users can attend "classes". There are three tables in my DB. I am using MySQL. I have four tables: hl_classes (int id, int professor, varchar class, text description) hl_classes_lessons (int id, int class_id, varchar lessonTitle, varchar lexiconLink, text lessonData) hl_classes_answers (int id, int lesson_id, int student, text submit_answer, int percent) hl_classes stores all of the classes on the website. The lessons are the individual lessons for each class. A class can have infinite lessons. Each lesson is available in a specific term. hl_classes_terms stores a list of all the terms and the current term has the field active = '1'. When a user submits their answers to a lesson it is stored in hl_classes_answers. A user can only answer each lesson once. Lessons have to be answered sequentially. All users attend all "classes". What I am trying to do is grab the next lesson for each user to do in each class. When the users start they are in term 1. When they complete all 10 lessons in each class they move on to term 2. When they finish lesson 20 for each class they move on to term 3. Let's say we know the term the user is in by the PHP variable $term. So this is my query I am currently trying to massage out but it doesn't work. Specifically because of the hC.id is unknown in the WHERE clause SELECT hC.id, hC.class, (SELECT MIN(output.id) as nextLessonID FROM ( SELECT id, class_id FROM hl_classes_lessons hL WHERE hL.class_id = hC.id ORDER BY hL.id LIMIT $term,10 ) as output WHERE output.id NOT IN (SELECT lesson_id FROM hl_classes_answers WHERE student = $USER_ID)) as nextLessonID FROM hl_classes hC My logic behind this query is first to For each class; select all of the lessons in the term the current user is in. From this sort out the lessons the user has already done and grab the MINIMUM id of the lessons yet to be done. This will be the lesson the user has to do. I hope I have made my question clear enough.

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Accidental Complexity in OpenSSL HMAC functions

    - by Hassan Syed
    SSL Documentation Analaysis This question is pertaining the usage of the HMAC routines in OpenSSL. Since Openssl documentation is a tad on the weak side in certain areas, profiling has revealed that using the: unsigned char *HMAC(const EVP_MD *evp_md, const void *key, int key_len, const unsigned char *d, int n, unsigned char *md, unsigned int *md_len); From here, shows 40% of my library runtime is devoted to creating and taking down **HMAC_CTX's behind the scenes. There are also two additional function to create and destroy a HMAC_CTX explicetly: HMAC_CTX_init() initialises a HMAC_CTX before first use. It must be called. HMAC_CTX_cleanup() erases the key and other data from the HMAC_CTX and releases any associated resources. It must be called when an HMAC_CTX is no longer required. These two function calls are prefixed with: The following functions may be used if the message is not completely stored in memory My data fits entirely in memory, so I choose the HMAC function -- the one whose signature is shown above. The context, as described by the man page, is made use of by using the following two functions: HMAC_Update() can be called repeatedly with chunks of the message to be authenticated (len bytes at data). HMAC_Final() places the message authentication code in md, which must have space for the hash function output. The Scope of the Application My application generates a authentic (HMAC, which is also used a nonce), CBC-BF encrypted protocol buffer string. The code will be interfaced with various web-servers and frameworks Windows / Linux as OS, nginx, Apache and IIS as webservers and Python / .NET and C++ web-server filters. The description above should clarify that the library needs to be thread safe, and potentially have resumeable processing state -- i.e., lightweight threads sharing a OS thread (which might leave thread local memory out of the picture). The Question How do I get rid of the 40% overhead on each invocation in a (1) thread-safe / (2) resume-able state way ? (2) is optional since I have all of the source-data present in one go, and can make sure a digest is created in place without relinquishing control of the thread mid-digest-creation. So, (1) can probably be done using thread local memory -- but how do I resuse the CTX's ? does the HMAC_final() call make the CTX reusable ?. (2) optional: in this case I would have to create a pool of CTX's. (3) how does the HMAC function do this ? does it create a CTX in the scope of the function call and destroy it ? Psuedocode and commentary will be useful.

    Read the article

  • Silverlight with MVVM Inheritance: ModelView and View matching the Model

    - by moonground.de
    Hello Stackoverflowers! :) Today I have a special question on Silverlight (4 RC) MVVM and inheritance concepts and looking for a best practice solution... I think that i understand the basic idea and concepts behind MVVM. My Model doesn't know anything about the ViewModel as the ViewModel itself doesn't know about the View. The ViewModel knows the Model and the Views know the ViewModels. Imagine the following basic (example) scenario (I'm trying to keep anything short and simple): My Model contains a ProductBase class with a few basic properties, a SimpleProduct : ProductBase adding a few more Properties and ExtendedProduct : ProductBase adding another properties. According to this Model I have several ViewModels, most essential SimpleProductViewModel : ViewModelBase and ExtendedProductViewModel : ViewModelBase. Last but not least, according Views SimpleProductView and ExtendedProductView. In future, I might add many product types (and matching Views + VMs). 1. How do i know which ViewModel to create when receiving a Model collection? After calling my data provider method, it will finally end up having a List<ProductBase>. It containts, for example, one SimpleProduct and two ExtendedProducts. How can I transform the results to an ObservableCollection<ViewModelBase> having the proper ViewModel types (one SimpleProductViewModel and two ExtendedProductViewModels) in it? I might check for Model type and construct the ViewModel accordingly, i.e. foreach(ProductBase currentProductBase in resultList) if (currentProductBase is SimpleProduct) viewModels.Add( new SimpleProductViewModel((SimpleProduct)currentProductBase)); else if (currentProductBase is ExtendedProduct) viewModels.Add( new ExtendedProductViewModels((ExtendedProduct)currentProductBase)); ... } ...but I consider this very bad practice as this code doesn't follow the object oriented design. The other way round, providing abstract Factory methods would reduce the code to: foreach(ProductBase currentProductBase in resultList) viewModels.Add(currentProductBase.CreateViewModel()) and would be perfectly extensible but since the Model doesn't know the ViewModels, that's not possible. I might bring interfaces into game here, but I haven't seen such approach proven yet. 2. How do i know which View to display when selecting a ViewModel? This is pretty the same problem, but on a higher level. Ended up finally having the desired ObservableCollection<ViewModelBase> collection would require the main view to choose a matching View for the ViewModel. In WPF, there is a DataTemplate concept which can supply a View upon a defined DataType. Unfortunately, this doesn't work in Silverlight and the only replacement I've found was the ResourceSelector of the SLExtensions toolkit which is buggy and not satisfying. Beside that, all problems from Question 1 apply as well. Do you have some hints or even a solution for the problems I describe, which you hopefully can understand from my explanation? Thank you in advance! Thomas

    Read the article

  • Having trouble on mouse over tabs

    - by user225269
    I downloaded a webpage template from the internet because I don't know how to design webpage on photoshop. This was the one I downloaded: http://www.freewebtemplates.com/download/templates/9839 And modified it. And I have this code for mouse over tabs from dynamic drive. But doesn't seem to be working with the template that I downloaded. Here is my current code: <script src="mouseovertabs.js" type="text/javascript"> </script> <meta http-equiv="content-type" content="text/html; charset=utf-8" /> <title>Designed by Web Page Templates</title> <meta name="keywords" content="" /> <meta name="description" content="" /> <link href="default.css" rel="stylesheet" type="text/css" /> </head> <body> <table border="0" align="center" cellpadding="0" cellspacing="0" class="bg1"> <tr> <td class="text1" style="height: 50px;">xd627 information management system</td> </tr> <tr> <div id="mytabsmenu" class="tabsmenuclass"> <td class="bg5"><table border="0" cellspacing="0" cellpadding="0" style="height: 62px; padding-top: 15px;"> <tr align="center"> <td><ul><li><a href="index.html" class="link1">Homepage</a></li></td> <td><li><a href="RegStuds.php" class="link1">Database</a></li></td> <td><li><a href="#" class="link1">About</a></li> </ul></td> <a href="submenucontents.htm" style="visibility:hidden">Sub Menu contents</a> <div id="mysubmenuarea" class="tabsmenucontentclass"> <!--1st link within submenu container should point to the external submenu contents file--> <a href="submenucontents.htm" style="visibility:hidden">Sub Menu contents</a> </div> <script type="text/javascript"> //mouseovertabsmenu.init("tabs_container_id", "submenu_container_id", "bool_hidecontentsmouseout") mouseovertabsmenu.init("mytabsmenu", "mysubmenuarea", true) </script> </div> What might be wrong here,its working perfectly with my previous one, but with no layout at all: <script src="mouseovertabs.js" type="text/javascript"> /*********************************************** * Mouseover Tabs Menu- (c) Dynamic Drive DHTML code library (www.dynamicdrive.com) * This notice MUST stay intact for legal use * Visit Dynamic Drive at http://www.dynamicdrive.com/ for this script and 100s more ***********************************************/ </script> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Untitled Document</title> </head> <body> <div id="mytabsmenu" class="tabsmenuclass"> <ul> <li><a href="" rel="gotsubmenu[selected]">Database Manipulation</a></li> <li><a href="" rel="gotsubmenu" >Register User</a></li> <li><a href="loginform2.php" rel="gotsubmenu" >Logout</a></li> <li><a href=""></a></li> </ul> </div> <div id="mysubmenuarea" class="tabsmenucontentclass"> <!--1st link within submenu container should point to the external submenu contents file--> <a href="submenucontents.htm" style="visibility:hidden">Sub Menu contents</a> </div> <script type="text/javascript"> //mouseovertabsmenu.init("tabs_container_id", "submenu_container_id", "bool_hidecontentsmouseout") mouseovertabsmenu.init("mytabsmenu", "mysubmenuarea", true) </script> </body> </html>

    Read the article

  • Bring object to the front, in Flash AS3

    - by jimbo
    Hi All, i have the below code, which is basically animating object across the screen, when roll-over happens it pauses the anim, and displays some information. Everything works fine, but when its paused, i wold like that current object to be 'on top' so other items run behind. I have looked at setChildIndex, but didn't have much luck. package { import flash.display.MovieClip; import flash.display.Sprite; import flash.events.MouseEvent; import flash.geom.Point; import flash.events.KeyboardEvent; import flash.events.*; import caurina.transitions.Tweener; import fl.motion.Color; public class carpurchase extends Sprite { public function carpurchase() { var carX = 570; //Set cars var car1:fullCar = new fullCar(); car1.info.alpha = 0; //var c:Color = new Color(); //c.setTint(0xff0000, 0.8); //car2.car.transform.colorTransform=c; car1.x = carX; car1.y = 280; car1.info.title.text = "test"; car1.info.desc.text = "test"; addChild(car1); car1.addEventListener(MouseEvent.ROLL_OVER, carPause); car1.addEventListener(MouseEvent.ROLL_OUT, carContinue); function car1Reset():void { Tweener.addTween(car1, {x:carX, time:0, onComplete:car1Tween}); } function car1Tween():void { Tweener.addTween(car1, {x:-120, time:2, delay:3, transition:"linear", onComplete:car1Reset}); } car1Tween(); var car2:fullCar = new fullCar(); car2.info.alpha = 0; var c:Color = new Color(); c.setTint(0xff0000, 0.8); car2.car.transform.colorTransform=c; car1.x = carX; car2.y = 175; car2.info.title.text = "test"; car2.info.desc.text = "test"; addChild(car2); car2.addEventListener(MouseEvent.ROLL_OVER, carPause); car2.addEventListener(MouseEvent.ROLL_OUT, carContinue); function car2Reset():void { Tweener.addTween(car2, {x:carX, time:0, onComplete:car2Tween}); } function car2Tween():void { Tweener.addTween(car2, {x:-120, time:3, delay:0, transition:"linear", onComplete:car2Reset}); } car2Tween(); function carPause(e:MouseEvent):void { Tweener.pauseTweens(e.target); Tweener.addTween(e.target.info, {y:-150, alpha:1, time:.5, transition:"easeout"}); } function carContinue(e:MouseEvent):void { Tweener.addTween(e.target.info, {y:10, alpha:0, time:.5, transition:"easeout"}); Tweener.resumeTweens(e.target); } } } Any help welcome

    Read the article

  • HttpTransportSE requestDump gives NullPointerException

    - by Chamila
    Hi, I'm trying to access a webservice in Android via Ksoap2 for android. The SoapObject is created ok, the S.o.p of the bodyOut outputs the desired strings. But when I do a requestDump of the HttpTransportSE object I create to make the call, a NullPointerException happens. In other words, the transport object is null. How can this happen? Web Service is at http://srilanka.lk:9080/services/CropServiceProxy?wsdl This service works very well with SoapUI. SoapUI Request <soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:v1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <soap:Header/> <soap:Body> <v1:getCropDataList> <v1:code>ABK</v1:code> </v1:getCropDataList> </soap:Body> </soap:Envelope> SoapUI Response <soapenv:Envelope xmlns:soapenv="http://www.w3.org/2003/05/soap-envelope"> <soapenv:Body> <ns1:getCropDataListResponse xmlns:ns1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>35.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>40.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> </ns1:getCropDataListResponse> </soapenv:Body> </soapenv:Envelope> Client Side Complex Type KvmSerializable implementation public class CropInfo implements KvmSerializable { private String name; private float price; private String location; @Override public Object getProperty(int arg0) { switch (arg0){ case 0: return name; case 1: return price; case 2: return location; default: return null; } } @Override public int getPropertyCount() { return 3; } @Override public void getPropertyInfo(int arg0, Hashtable arg1, PropertyInfo arg2) { switch (arg0){ case 0: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Name"; break; case 1: arg2.type = Float.class; arg2.name = "Price"; break; case 2: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Location"; break; default: break; } } @Override public void setProperty(int arg0, Object arg1) { switch(arg0){ case 0: name = arg1.toString(); break; case 1: price = Float.parseFloat(arg1.toString()); case 2: location = arg1.toString(); default: break; } } } Web Service Call public void btnOnClick(View v){ String NAMESPACE = "http://schemas.icta.lk/xsd/crop/handler/v1/"; String URL = "http://220.247.225.202:9080/services/CropServiceProxy.CropServiceProxyHttpSoap12Endpoint"; String method_name = "getCropDataList"; String SOAP_ACTION = "http://schemas.icta.lk/xsd/crop/handler/v1/getCropDataList"; SoapObject soap_request = new SoapObject(NAMESPACE, method_name); soap_request.addProperty("code", "ABK" ); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.setOutputSoapObject(soap_request); envelope.addMapping(NAMESPACE, "cropInfo", CropInfo.class); //envelope.dotNet=true; Marshal floatMarshal = new MarshalFloat(); floatMarshal.register(envelope); System.out.println("body out : " + envelope.bodyOut.toString()); //AndroidHttpTransport http_transport = new AndroidHttpTransport(URL); HttpTransportSE http_transport = new HttpTransportSE(URL); try { //NullPointerException HERE System.out.println(http_transport.requestDump); http_transport.call(SOAP_ACTION, envelope); //because we should expect a vector, two kinds of prices are given Vector<CropInfo> result_array = (Vector<CropInfo>)envelope.getResponse(); if(result_array != null){ for (CropInfo current_crop: result_array){ System.out.println(current_crop.getName()); System.out.println(Float.toString(current_crop.getPrice())); } } } catch (Exception e) { e.printStackTrace(); answer.setText("error caught"); //System.out.println(http_transport.responseDump); } // String result_string[] = (String[])result; //answer.setText("returned"); } Can anyone explain this?

    Read the article

  • linux thread synchronization

    - by johnnycrash
    I am new to linux and linux threads. I have spent some time googling to try to understand the differences between all the functions available for thread synchronization. I still have some questions. I have found all of these different types of synchronizations, each with a number of functions for locking, unlocking, testing the lock, etc. gcc atomic operations futexes mutexes spinlocks seqlocks rculocks conditions semaphores My current (but probably flawed) understanding is this: semaphores are process wide, involve the filesystem (virtually I assume), and are probably the slowest. Futexes might be the base locking mechanism used by mutexes, spinlocks, seqlocks, and rculocks. Futexes might be faster than the locking mechanisms that are based on them. Spinlocks dont block and thus avoid context swtiches. However they avoid the context switch at the expense of consuming all the cycles on a CPU until the lock is released (spinning). They should only should be used on multi processor systems for obvious reasons. Never sleep in a spinlock. The seq lock just tells you when you finished your work if a writer changed the data the work was based on. You have to go back and repeat the work in this case. Atomic operations are the fastest synch call, and probably are used in all the above locking mechanisms. You do not want to use atomic operations on all the fields in your shared data. You want to use a lock (mutex, futex, spin, seq, rcu) or a single atomic opertation on a lock flag when you are accessing multiple data fields. My questions go like this: Am I right so far with my assumptions? Does anyone know the cpu cycle cost of the various options? I am adding parallelism to the app so we can get better wall time response at the expense of running fewer app instances per box. Performances is the utmost consideration. I don't want to consume cpu with context switching, spinning, or lots of extra cpu cycles to read and write shared memory. I am absolutely concerned with number of cpu cycles consumed. Which (if any) of the locks prevent interruption of a thread by the scheduler or interrupt...or am I just an idiot and all synchonization mechanisms do this. What kinds of interruption are prevented? Can I block all threads or threads just on the locking thread's CPU? This question stems from my fear of interrupting a thread holding a lock for a very commonly used function. I expect that the scheduler might schedule any number of other workers who will likely run into this function and then block because it was locked. A lot of context switching would be wasted until the thread with the lock gets rescheduled and finishes. I can re-write this function to minimize lock time, but still it is so commonly called I would like to use a lock that prevents interruption...across all processors. I am writing user code...so I get software interrupts, not hardware ones...right? I should stay away from any functions (spin/seq locks) that have the word "irq" in them. Which locks are for writing kernel or driver code and which are meant for user mode? Does anyone think using an atomic operation to have multiple threads move through a linked list is nuts? I am thinking to atomicly change the current item pointer to the next item in the list. If the attempt works, then the thread can safely use the data the current item pointed to before it was moved. Other threads would now be moved along the list. futexes? Any reason to use them instead of mutexes? Is there a better way than using a condition to sleep a thread when there is no work? When using gcc atomic ops, specifically the test_and_set, can I get a performance increase by doing a non atomic test first and then using test_and_set to confirm? *I know this will be case specific, so here is the case. There is a large collection of work items, say thousands. Each work item has a flag that is initialized to 0. When a thread has exclusive access to the work item, the flag will be one. There will be lots of worker threads. Any time a thread is looking for work, they can non atomicly test for 1. If they read a 1, we know for certain that the work is unavailable. If they read a zero, they need to perform the atomic test_and_set to confirm. So if the atomic test_and_set is 500 cpu cycles because it is disabling pipelining, causes cpu's to communicate and L2 caches to flush/fill .... and a simple test is 1 cycle .... then as long as I had a better ratio of 500 to 1 when it came to stumbling upon already completed work items....this would be a win.* I hope to use mutexes or spinlocks to sparilngly protect sections of code that I want only one thread on the SYSTEM (not jsut the CPU) to access at a time. I hope to sparingly use gcc atomic ops to select work and minimize use of mutexes and spinlocks. For instance: a flag in a work item can be checked to see if a thread has worked it (0=no, 1=yes or in progress). A simple test_and_set tells the thread if it has work or needs to move on. I hope to use conditions to wake up threads when there is work. Thanks!

    Read the article

  • PHP mtChart (new pChart): how do i control the angle of x-axis labels?

    - by gsquare567
    i am trying to graph the results of a survey, where the question is multiple choice. eg. How would you describe this website? format: option | number of times selected | percentage of users who selected that option Informative 1 50% All of the above 1 50% Interesting 0 0% Intelligent 0 0% Cool 0 0% Incredible 0 0% Sleek 0 0% Amazing the graph is a bar graph, where each bar represents one of those options, and the height of the bar depends on the number of times selected. however, the labels are slanted at a 45 degree angle and are barely readable! here is my code: <?php require_once ("includes/common.php"); require_once ("graph/mtChart.min.php"); // type must be specified $type = $_GET['type']; if($type == "surveys_report_MC_or_CB") { // PARAMS $surveyID = $_GET['surveyID']; $questionID = $_GET['questionID']; // END PARAMS $question = SurveyQuestions::getSingle($questionID); $answers = SurveyAnswers::getAll($questionID); $options = SurveyQuestionOptions::getAll($question[SurveyQuestions::surveyQuestionID]); $others = SurveyAnswers::setOptionCounts($options, $answers); $printedOthers = false; // set graph $values = array(); $axisLabels = array(); foreach($options as $option) { $values[$option[SurveyQuestionOptions::optionText]] = $option['count']; $axisLabels[] = $option[SurveyQuestionOptions::optionText]; } $graphs = array(); $graphs[0] = $values; $xName = "Option"; $yName = "Number of Times Selected"; $graphTitle = $question[SurveyQuestions::question]; $series = array("Total"); $showLegend = false; $tall = false; } drawGraph($graphs, $axisLabels, $xName, $yName, $graphTitle, $series, $showLegend, $tall); function drawGraph($graphs, $axisLabels, $xName, $yName, $graphTitle, $series, $showLegend, $tall) { $Graph = ($tall) ? new mtChart(575,375) : new mtChart(575,275); // Dataset definition $avg = 0; $i = 0; foreach ($graphs as $key => $value) { $Graph->AddPoint($value,"series" . $key); $Graph->SetSerieName($series[$key],"series" . $key); // Get average $avg += array_sum($value); $size = sizeof($value); $i += $size; // Calculate x-axis tick interval $step = ceil($size / 25); } $Graph->AddPoint($axisLabels,"XLabel"); $Graph->AddAllSeries(); $Graph->RemoveSerie("XLabel"); $Graph->SetAbsciseLabelSerie("XLabel"); $Graph->SetXAxisName($xName); $Graph->SetYAxisName($yName); // Get from cache if it exists $Graph->enableCaching(NULL, 'graph/cache/'); $Graph->GetFromCache(); // Initialize the graph $Graph->setInterval($step); $Graph->setFontProperties("graph/tahoma.ttf",8); ($showLegend) ? $Graph->setGraphArea(45,30,475,200) : $Graph->setGraphArea(75,30,505,200); $Graph->drawGraphArea(255,255,255,TRUE); $Graph->drawScale(SCALE_START0,100,100,100,TRUE,55,1,TRUE); $Graph->drawGrid(4,TRUE,230,230,230,50); // Draw the 0 line $Graph->setFontProperties("graph/tahoma.ttf",6); $Graph->drawTreshold(0,143,55,72,TRUE,TRUE); // Draw the bar graph $Graph->drawBarGraph(); // Draw average line $Graph->drawTreshold($avg/$i, 0, 0, 0, FALSE, FALSE, 5); // Finish the graph $Graph->setFontProperties("graph/tahoma.ttf",8); if ($showLegend) { $Graph->drawLegend(482,30,255,255,255,255,255,255,100,100,100); } $Graph->setFontProperties("graph/tahoma.ttf",10); $Graph->drawTitle(0,22,$graphTitle,100,100,100,555); // Draw Graph $Graph->Stroke(); } and here is where i use it on the page: <div class="graph_container"> <img src="drawGraph.php?type=surveys_report_MC_or_CB&surveyID=<?php echo $survey[Surveys::surveyID] ?>&questionID=<?php echo $question[SurveyQuestions::surveyQuestionID] ?>" /> is there a setting i can apply to the graph which will make the text look nicer, or at least let me set the angle to 90 degrees so people can read it if they cock their head to the left? thanks! btw, mtchart is located here: http://code.google.com/p/mtchart/ and pchart (the original, which has mainly the same code) is here: http://pchart.sourceforge.net/documentation.php

    Read the article

  • Internet Explorer and onMouseOver/onMouseOut

    - by Thorbjørn Reimann-Andersen
    Hi all, I have tried looking a similar question on here but couldnt find one so here it comes: I have this html (ignore the "+whatever+@", its in a codebehind file so im putting some variables that im getting from there): <div id='ReferenceContainer"+UniqueID+@"' style='background-color:"+BackcolourOFF+@"; width:"+CompWidth+@"; height:"+CompHeight+@";'> <div id='Reference"+UniqueID+@"' style='width:"+CompWidth+@"; height:"+CompHeight+@"; '> <div id='RefTextContainer"+UniqueID+@"' style='float:left; width:"+CompWidth+@"; height:"+CompHeight+@"; ' > <div id='RefTitleCon' style='margin-top:"+RefTitleMargin+@"px; color:"+RefTitleColor+@"; z-index:-1;' ><p><b>"+RefTitle+@"</b></p> </div> <div id='RefTextCon'><p>"+RefText+@"</p></div> </div> <div id='RefPicContainer"+UniqueID+@"' style='float:right;'> <img id='RefImg"+UniqueID+@"first' class='first' name='RefImg"+UniqueID+@"' src=" + StartImg + @" style='position:absolute;' ></img> <img id='RefImg"+UniqueID+@"second' class='second' name='RefImg"+UniqueID+@"' src=" + AltImg + @" style='display:none;' ></img> </div> </div> <div id='ScriptContainer"+UniqueID+@"' style='width:"+CompWidth+@"; height:"+CompHeight+@"; position:relative; top:-"+CompHeight+@"px; left:0px;' onMouseOver='ChangeBackcolourON"+UniqueID+@"()' onMouseOut='ChangeBackcolourOFF"+UniqueID+@"()'></div> </div> Now in firefox, everything works just perfect. The div "ScriptContainer" sits in front of the whole thing and when the mouse enters or leaves the functions work exactly as they should. But IE8 places the text in front of everything and then the functions do not work as i would like them to. "ChangeBackcolourOFF" gets called every time the mouse enters the text, which sits in front of everything and "ChangeBackcolourON" gets called every time the mouse enters the "Scriptcontainer" from the text. So i either need to figure out how to force the text to be placed behind the "Scriptcontainer" or some other solutions. I appreciate you answers

    Read the article

  • create new inbox folder and save emails

    - by kasunmit
    i am trying http://www.c-sharpcorner.com/uploadfile/rambab/outlookintegration10282006032802am/outlookintegration.aspx[^] this code for create inbox personal folder and save same mails at the datagrid view (outlook 2007 and vsto 2008) i am able to create inbox folder according to above example but couldn't wire code for save e-mails at that example to save contect they r using following code if (chkVerify.Checked) { OutLook._Application outlookObj = new OutLook.Application(); MyContact cntact = new MyContact(); cntact.CustomProperty = txtProp1.Text.Trim().ToString(); //CREATING CONTACT ITEM OBJECT AND FINDING THE CONTACT ITEM OutLook.ContactItem newContact = (OutLook.ContactItem)FindContactItem(cntact, CustomFolder); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . if (newContact != null) { newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if(string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } else { //IF THE CONTACT DOES NOT EXIST WITH SAME CUSTOM PROPERTY CREATES THE CONTACT. newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { OutLook._Application outlookObj = new OutLook.Application(); OutLook.ContactItem newContact = (OutLook.ContactItem)CustomFolder.Items.Add(OutLook.OlItemType.olContactItem); newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); if (chkAdd.Checked) { //HERE WE CAN CREATE OUR OWN CUSTOM PROPERTY TO IDENTIFY OUR APPLICATION. if (string.IsNullOrEmpty(txtProp1.Text.Trim().ToString())) { MessageBox.Show("please add value to Your Custom Property"); return; } newContact.UserProperties.Add("myPetName", OutLook.OlUserPropertyType.olText, true, OutLook.OlUserPropertyType.olText); newContact.UserProperties["myPetName"].Value = txtProp1.Text.Trim().ToString(); } newContact.Save(); this.Close(); } } else { //CREATES THE OUTLOOK CONTACT IN DEFAULT CONTACTS FOLDER. OutLook._Application outlookObj = new OutLook.Application(); OutLook.MAPIFolder fldContacts = (OutLook.MAPIFolder)outlookObj.Session.GetDefaultFolder(OutLook.OlDefaultFolders.olFolderContacts); OutLook.ContactItem newContact = (OutLook.ContactItem)fldContacts.Items.Add(OutLook.OlItemType.olContactItem); //THE VALUES WE CAN GET FROM WEB SERVICES OR DATA BASE OR CLASS. WE HAVE TO ASSIGN THE VALUES //TO OUTLOOK CONTACT ITEM OBJECT . newContact.FirstName = txtFirstName.Text.Trim().ToString(); newContact.LastName = txtLastName.Text.Trim().ToString(); newContact.Email1Address = txtEmail.Text.Trim().ToString(); newContact.Business2TelephoneNumber = txtPhone.Text.Trim().ToString(); newContact.BusinessAddress = txtAddress.Text.Trim().ToString(); newContact.Save(); this.Close(); } } /// /// ENABLING AND DISABLING THE CUSTOM FOLDER AND PROPERY OPTIONS. /// /// /// private void rdoCustom_CheckedChanged(object sender, EventArgs e) { if (rdoCustom.Checked) { txFolder.Enabled = true; chkAdd.Enabled = true; chkVerify.Enabled = true; txtProp1.Enabled = true; } else { txFolder.Enabled = false; chkAdd.Enabled = false; chkVerify.Enabled = false; txtProp1.Enabled = false; } } i don t have idea to convert it to save e-mails in the datagrid view the data gride view i am mentioning here is containing details (sender address, subject etc.) of unread mails and the i i am did was perform some filter for that mails as follows string senderMailAddress = txtMailAddress.Text.ToLower(); List list = (List)dgvUnreadMails.DataSource; List myUnreadMailList; List filteredList = (List)(from ci in list where ci.SenderAddress.StartsWith(senderMailAddress) select ci).ToList(); dgvUnreadMails.DataSource = filteredList; it was done successfully then i need to save those filtered e-mails to that personal inbox folder i created already for that pls give me some help my issue is that how can i assign outlook object just like they assign it to contacts (name, address, e-mail etc.) because in the e-mails we couldn't find it ..

    Read the article

  • How should I model the database for this problem? And which ORM can handle it?

    - by Kristof Claes
    I need to build some sort of a custom CMS for a client of ours. These are some of the functional requirements: Must be able to manage the list of Pages in the site Each Page can contain a number of ColumnGroups A ColumnGroup is nothing more than a list of Columns in a certain ColumnGroupLayout. For example: "one column taking up the entire width of the page", "two columns each taking up half of the width", ... Each Column can contain a number ContentBlocks Examples of a ContentBlock are: TextBlock, NewsBlock, PictureBlock, ... ContentBlocks can be given a certain sorting within a Column A ContentBlock can be put in different Columns so that content can be reused without having to be duplicated. My first quick draft of how this could look like in C# code (we're using ASP.NET 4.0 to develop the CMS) can be found at the bottom of my question. One of the technical requirements is that it must be as easy as possible to add new types of ContentBlocks to the CMS. So I would like model everything as flexible as possible. Unfortunately, I'm already stuck at trying to figure out how the database should look like. One of the problems I'm having has to do with sorting different types of ContentBlocks in a Column. I guess each type of ContentBlock (like TextBlock, NewsBlock, PictureBlock, ...) should have it's own table in the database because each has it's own different fields. A TextBlock might only have a field called Text whereas a NewsBlock might have fields for the Text, the Summary, the PublicationDate, ... Since one Column can have ContentBlocks located in different tables, I guess I'll have to create a many-to-many association for each type of ContentBlock. For example: ColumnTextBlocks, ColumnNewsBlocks and ColumnPictureBlocks. The problem I have with this setup is the sorting of the different ContentBlocks in a column. This could be something like this: TextBlock NewsBlock TextBlock TextBlock PictureBlock Where do I store the sorting number? If I store them in the associaton tables, I'll have to update a lot of tables when changing the sorting order of ContentBlocks in a Column. Is this a good approach to the problem? Basically, my question is: What is the best way to model this keeping in mind that it should be easy to add new types of ContentBlocks? My next question is: What ORM can deal with that kind of modeling? To be honest, we are ORM-virgins at work. I have been reading a bit about Linq-to-SQL and NHibernate, but we have no experience with them. Because of the IList in the Column class (see code below) I think we can rule out Linq-to-SQL, right? Can NHibernate handle the mapping of data from many different tables to one IList? Also keep in mind that this is just a very small portion of the domain. Other parts are Users belonging to a certain UserGroup having certain Permissions on Pages, ColumnGroups, Columns and ContentBlocks. The code (just a quick first draft): public class Page { public int PageID { get; set; } public string Title { get; set; } public string Description { get; set; } public string Keywords { get; set; } public IList<ColumnGroup> ColumnGroups { get; set; } } public class ColumnGroup { public enum ColumnGroupLayout { OneColumn, HalfHalf, NarrowWide, WideNarrow } public int ColumnGroupID { get; set; } public ColumnGroupLayout Layout { get; set; } public IList<Column> Columns { get; set; } } public class Column { public int ColumnID { get; set; } public IList<IContentBlock> ContentBlocks { get; set; } } public interface IContentBlock { string GetSummary(); } public class TextBlock : IContentBlock { public string GetSummary() { return "I am a piece of text."; } } public class NewsBlock : IContentBlock { public string GetSummary() { return "I am a news item."; } }

    Read the article

  • gcc/g++: error when compiling large file

    - by Alexander
    Hi, I have a auto-generated C++ source file, around 40 MB in size. It largely consists of push_back commands for some vectors and string constants that shall be pushed. When I try to compile this file, g++ exits and says that it couldn't reserve enough virtual memory (around 3 GB). Googling this problem, I found that using the command line switches --param ggc-min-expand=0 --param ggc-min-heapsize=4096 may solve the problem. They, however, only seem to work when optimization is turned on. 1) Is this really the solution that I am looking for? 2) Or is there a faster, better (compiling takes ages with these options acitvated) way to do this? Best wishes, Alexander Update: Thanks for all the good ideas. I tried most of them. Using an array instead of several push_back() operations reduced memory usage, but as the file that I was trying to compile was so big, it still crashed, only later. In a way, this behaviour is really interesting, as there is not much to optimize in such a setting -- what does the GCC do behind the scenes that costs so much memory? (I compiled with deactivating all optimizations as well and got the same results) The solution that I switched to now is reading in the original data from a binary object file that I created from the original file using objcopy. This is what I originally did not want to do, because creating the data structures in a higher-level language (in this case Perl) was more convenient than having to do this in C++. However, getting this running under Win32 was more complicated than expected. objcopy seems to generate files in the ELF format, and it seems that some of the problems I had disappeared when I manually set the output format to pe-i386. The symbols in the object file are by standard named after the file name, e.g. converting the file inbuilt_training_data.bin would result in these two symbols: binary_inbuilt_training_data_bin_start and binary_inbuilt_training_data_bin_end. I found some tutorials on the web which claim that these symbols should be declared as extern char _binary_inbuilt_training_data_bin_start;, but this does not seem to be right -- only extern char binary_inbuilt_training_data_bin_start; worked for me.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is two-way binding in silverlight not working?

    - by Edward Tanguay
    According to how Silverlight TwoWay binding works, when I change the data in the FirstName field, it should change the value in CheckFirstName field. Why is this not the case? ANSWER: Thank you Jeff, that was it, for others: here is the full solution with downloadable code. XAML: <StackPanel> <Grid x:Name="GridCustomerDetails"> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition Height="Auto"/> <RowDefinition Height="*"/> </Grid.RowDefinitions> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto"/> <ColumnDefinition Width="300"/> </Grid.ColumnDefinitions> <TextBlock VerticalAlignment="Center" Margin="10" Grid.Row="0" Grid.Column="0">First Name:</TextBlock> <TextBox Margin="10" Grid.Row="0" Grid.Column="1" Text="{Binding FirstName, Mode=TwoWay}"/> <TextBlock VerticalAlignment="Center" Margin="10" Grid.Row="1" Grid.Column="0">Last Name:</TextBlock> <TextBox Margin="10" Grid.Row="1" Grid.Column="1" Text="{Binding LastName}"/> <TextBlock VerticalAlignment="Center" Margin="10" Grid.Row="2" Grid.Column="0">Address:</TextBlock> <TextBox Margin="10" Grid.Row="2" Grid.Column="1" Text="{Binding Address}"/> </Grid> <Border Background="Tan" Margin="10"> <TextBlock x:Name="CheckFirstName"/> </Border> </StackPanel> Code behind: public Page() { InitializeComponent(); Customer customer = new Customer(); customer.FirstName = "Jim"; customer.LastName = "Taylor"; customer.Address = "72384 South Northern Blvd."; GridCustomerDetails.DataContext = customer; Customer customerOutput = (Customer)GridCustomerDetails.DataContext; CheckFirstName.Text = customer.FirstName; }

    Read the article

  • Display multiple new windows

    - by Ricardo Deano
    Afternoon all. I have the following scenario: I have a search page where by a client searches for a product from a drop down list, upon clicking a button, a gridview is produced display the spec. What I would like is the functionality for the user to make their selection and a new window pops up with the spec. So I have a simple code behind for the search page: protected void Button1_Click(object sender, EventArgs e) { Session["Product"] = DropDownList1.SelectedValue; string strScript = "window.open('GridViewPage.aspx', 'Key', 'height=500,width=800,toolbar=no,menubar=no,scrollbars=yes,resizable=yes,titlebar=no');"; ScriptManager.RegisterStartupScript(this, typeof(string), "", strScript, true); } And a gridviewpage that presents the data based upon the session created in the search page: <asp:GridView ID="GridView2" runat="server" AutoGenerateColumns="False" DataSourceID="LinqDataSource1"> <Columns> <asp:BoundField DataField="Product" HeaderText="MemberID" SortExpression="MemberID" /> <asp:BoundField DataField="Spec" HeaderText="Spec" SortExpression="Spec" /> </Columns> </asp:GridView> <asp:LinqDataSource ID="LinqDataSource1" runat="server" ContextTypeName="GridViewInNewWindow.ProductDataContext" EntityTypeName="" TableName="tblProducts" Where="Product == @Product"> <WhereParameters> <asp:SessionParameter Name="Product" SessionField="Product" Type="String" /> </WhereParameters> </asp:LinqDataSource> Now upon first iteration, this does the job...gridview presented in new window...hurrah! i.e. a user searches for egg, the spec for an egg is presented in a new window. However, what I would like to happen is that the user can make multiple searches so a number of new windows are opened. i.e. a user searches for egg once, the spec is returned in a new window; they then wish to see the spec for a chicken, so they use the search page to find said chicken, click the button and another new window is shown displaying the chicken's specs. Does anyone know how I can achieve this? Apologies if this is simple stuff, I am just finding my feet.

    Read the article

  • OpenGL textures trigger error 1281 and strange background behavior

    - by user3714670
    I am using SOIL to apply textures to VBOs, without textures i could change the background and display black (default color) vbos easily, but now with textures, openGL is giving an error 1281, the background is black and some textures are not applied. There must be something i didn't understand about applying/loading the textures. BUt the texture IS applied (nothing else is working though), the error is applied when i try to use the shader program however i checked the compilation of these and no problems were written. Here is the code i use to load textures, once loaded it is kept in memory, it mostly comes from the example of SOIL : texture = SOIL_load_OGL_single_cubemap( filename, SOIL_DDS_CUBEMAP_FACE_ORDER, SOIL_LOAD_AUTO, SOIL_CREATE_NEW_ID, SOIL_FLAG_POWER_OF_TWO | SOIL_FLAG_MIPMAPS | SOIL_FLAG_DDS_LOAD_DIRECT ); if( texture > 0 ) { glEnable( GL_TEXTURE_CUBE_MAP ); glEnable( GL_TEXTURE_GEN_S ); glEnable( GL_TEXTURE_GEN_T ); glEnable( GL_TEXTURE_GEN_R ); glTexGeni( GL_S, GL_TEXTURE_GEN_MODE, GL_REFLECTION_MAP ); glTexGeni( GL_T, GL_TEXTURE_GEN_MODE, GL_REFLECTION_MAP ); glTexGeni( GL_R, GL_TEXTURE_GEN_MODE, GL_REFLECTION_MAP ); glBindTexture( GL_TEXTURE_CUBE_MAP, texture ); std::cout << "the loaded single cube map ID was " << texture << std::endl; } else { std::cout << "Attempting to load as a HDR texture" << std::endl; texture = SOIL_load_OGL_HDR_texture( filename, SOIL_HDR_RGBdivA2, 0, SOIL_CREATE_NEW_ID, SOIL_FLAG_POWER_OF_TWO | SOIL_FLAG_MIPMAPS ); if( texture < 1 ) { std::cout << "Attempting to load as a simple 2D texture" << std::endl; texture = SOIL_load_OGL_texture( filename, SOIL_LOAD_AUTO, SOIL_CREATE_NEW_ID, SOIL_FLAG_POWER_OF_TWO | SOIL_FLAG_MIPMAPS | SOIL_FLAG_DDS_LOAD_DIRECT ); } if( texture > 0 ) { // enable texturing glEnable( GL_TEXTURE_2D ); // bind an OpenGL texture ID glBindTexture( GL_TEXTURE_2D, texture ); std::cout << "the loaded texture ID was " << texture << std::endl; } else { glDisable( GL_TEXTURE_2D ); std::cout << "Texture loading failed: '" << SOIL_last_result() << "'" << std::endl; } } and how i apply it when drawing : GLuint TextureID = glGetUniformLocation(shaderProgram, "myTextureSampler"); if(!TextureID) cout << "TextureID not found ..." << endl; // glEnableVertexAttribArray(TextureID); glActiveTexture(GL_TEXTURE0); if(SFML) sf::Texture::bind(sfml_texture); else { glBindTexture (GL_TEXTURE_2D, texture); // glTexImage2D(GL_TEXTURE_2D, 0, GL_RGB, 1024, 768, 0, GL_RGB, GL_UNSIGNED_BYTE, &texture); } glUniform1i(TextureID, 0); I am not sure that SOIL is adapted to my program as i want something as simple as possible (i used sfml's texture object which was the best but i can't anymore), but if i can get it to work it would be great. EDIT : After narrowing the code implied by the error, here is the code that provokes it, it is called between texture loading and bos drawing : glEnableClientState(GL_VERTEX_ARRAY); //this gives the error : glUseProgram(this->shaderProgram); if (!shaderLoaded) { std::cout << "Loading default shaders" << std::endl; if(textured) loadShaderProgramm(texture_vertexSource, texture_fragmentSource); else loadShaderProgramm(default_vertexSource,default_fragmentSource); } glm::mat4 Projection = camera->getPerspective(); glm::mat4 View = camera->getView(); glm::mat4 Model = glm::mat4(1.0f); Model[0][0] *= scale_x; Model[1][1] *= scale_y; Model[2][2] *= scale_z; glm::vec3 translate_vec(this->x,this->y,this->z); glm::mat4 object_transform = glm::translate(glm::mat4(1.0f),translate_vec); glm::quat rotation = QAccumulative.getQuat(); glm::mat4 matrix_rotation = glm::mat4_cast(rotation); object_transform *= matrix_rotation; Model *= object_transform; glm::mat4 MVP = Projection * View * Model; GLuint ModelID = glGetUniformLocation(this->shaderProgram, "M"); if(ModelID ==-1) cout << "ModelID not found ..." << endl; GLuint MatrixID = glGetUniformLocation(this->shaderProgram, "MVP"); if(MatrixID ==-1) cout << "MatrixID not found ..." << endl; GLuint ViewID = glGetUniformLocation(this->shaderProgram, "V"); if(ViewID ==-1) cout << "ViewID not found ..." << endl; glUniformMatrix4fv(MatrixID, 1, GL_FALSE, &MVP[0][0]); glUniformMatrix4fv(ModelID, 1, GL_FALSE, &Model[0][0]); glUniformMatrix4fv(ViewID, 1, GL_FALSE, &View[0][0]); drawObject();

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • Add new row to asp .net grid view using button

    - by SARAVAN
    Hi, I am working in ASP .net 2.0. I am a learner. I have a grid view which has a button in it. Please find the asp mark up below <form id="form1" runat="server"> <div> <asp:GridView ID="myGridView" runat="server"> <Columns> <asp:TemplateField> <ItemTemplate> <asp:Button CommandName="AddARowBelow" Text="Add A Row Below" runat="server" /> </ItemTemplate> </asp:TemplateField> </Columns> </asp:GridView> </div> </form> Please find the code behind below. using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Web.UI; using System.Data; using System.Web.UI.WebControls; namespace GridViewDemo { public partial class _Default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { DataTable dt = new DataTable("myTable"); dt.Columns.Add("col1"); dt.Columns.Add("col2"); dt.Columns.Add("col3"); dt.Rows.Add(1, 2, 3); dt.Rows.Add(1, 2, 3); dt.Rows.Add(1, 2, 3); dt.Rows.Add(1, 2, 3); dt.Rows.Add(1, 2, 3); myGridView.DataSource = dt; myGridView.DataBind(); } protected void myGridView_RowCommand(object sender, GridViewCommandEventArgs e) { } } } I was thinking that when I click the command button, it would fire the mygridview_rowcommand() but instead it threw an error as follows: Invalid postback or callback argument. Event validation is enabled using in configuration or <%@ Page EnableEventValidation="true" % in a page. For security purposes, this feature verifies that arguments to postback or callback events originate from the server control that originally rendered them. If the data is valid and expected, use the ClientScriptManager.RegisterForEventValidation method in order to register the postback or callback data for validation. Can any one let me know on where I am going wrong?

    Read the article

  • C Language: Why I cannot transfer file from server to client?

    - by user275753
    I want to ask, why I cannot transfer file from server to client? When I start to send the file from server, the client side program will have problem. So, I spend some times to check the code, But I still cannot find out the problem Can anyone point out the problem for me? thanks a lot! [client side code] include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 define true 1 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET sockfd; int number,message; char outbuff[MAXLEN],inbuff[MAXLEN]; char PWD_buffer[_MAX_PATH]; struct sockaddr_in servaddr; FILE *fp; int numbytes; char buf[2048]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); if (argc != 2) errexit("client IPaddress"); if ( (sockfd = socket(AF_INET, SOCK_STREAM, 0)) == INVALID_SOCKET ) errexit("socket error: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_port = htons(S_PORT); if ( (servaddr.sin_addr.s_addr = inet_addr(argv[1])) == INADDR_NONE) errexit("inet_addr error: error number %d\n", WSAGetLastError()); if (connect(sockfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("connect error: error number %d\n", WSAGetLastError()); if ( (fp = fopen("C:\\users\\pc\\desktop\\COPY.c", "wb")) == NULL){ perror("fopen"); exit(1); } printf("Still NO PROBLEM!\n"); //Receive file from server while(1){ numbytes = read(sockfd, buf, sizeof(buf)); printf("read %d bytes, ", numbytes); if(numbytes == 0){ printf("\n"); break; } numbytes = fwrite(buf, sizeof(char), numbytes, fp); printf("fwrite %d bytes\n", numbytes); } fclose(fp); close(sockfd); return 0; } server side code include include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET listenfd, connfd; int number, message, numbytes; int h, i, j, alen; int nread; struct sockaddr_in servaddr, cliaddr; FILE *in_file, *out_file, *fp; char buf[4096]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); listenfd = socket(AF_INET, SOCK_STREAM, 0); if (listenfd == INVALID_SOCKET) errexit("cannot create socket: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_addr.s_addr = htonl(INADDR_ANY); servaddr.sin_port = htons(S_PORT); if (bind(listenfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("can't bind to port %d: error number %d\n", S_PORT, WSAGetLastError()); if (listen(listenfd, 5) == SOCKET_ERROR) errexit("can't listen on port %d: error number %d\n", S_PORT, WSAGetLastError()); alen = sizeof(SA); connfd = accept(listenfd, (SA *) &cliaddr, &alen); if (connfd == INVALID_SOCKET) errexit("accept failed: error number %d\n", WSAGetLastError()); printf("accept one client from %s!\n", inet_ntoa(cliaddr.sin_addr)); fp = fopen ("client.c", "rb"); // open file stored in server if (fp == NULL) { printf("\nfile NOT exist"); } //Sending file while(!feof(fp)){ numbytes = fread(buf, sizeof(char), sizeof(buf), fp); printf("fread %d bytes, ", numbytes); numbytes = write(connfd, buf, numbytes); printf("Sending %d bytes\n",numbytes); } fclose (fp); closesocket(listenfd); closesocket(connfd); return 0; }

    Read the article

  • How to update the session values on partial post back and how to make Javascript use the new values

    - by Mano
    The problem I am facing is the I am passing values to javascript to draw a graph using session values in the code behind. When page loads it take the value from the session and creates the graph, when I do partial post back using a Update Panel and Timer, I call the method to add values to the session and it does it. public void messsagePercentStats(object sender, EventArgs args) { ... if (value >= lowtarg && value < Toptarg) { vProgressColor = "'#eaa600'"; } else if (value >= Toptarg) { vProgressColor = "'#86cf21'"; } Session.Add("vProgressColor", vProgressColor); Session.Add("vProgressPercentage", "["+value+"],["+remaining+"]"); } } I use the update panel to call the above method <asp:ScriptManager ID="smCharts" runat="server" /> <asp:UpdatePanel runat="server" ID="Holder" OnLoad="messsagePercentStats" UpdateMode="Conditional"> <ContentTemplate> <asp:Timer ID="Timer1" runat="server" Interval="5000" OnTick="Timer_Tick" /> and the timer_tick method is executed every 5 seconds protected void Timer_Tick(object sender, EventArgs args) { ScriptManager.RegisterStartupScript(this, this.GetType(), "key", "r.init();", true); ResponseMetric rm = new ResponseMetric(); Holder.Update(); } I use ScriptManager.RegisterStartupScript(this, this.GetType(), "key", "r.init();", true); to call the r.init() Java script method to draw the graph on post back and it works fine. Java Script: var r = { init : function(){ r = Raphael("pie"), data2 = [<%= Session["vProgressPercentage"] %>]; axisx = ["10%", "20%"]; r.g.txtattr.font = "12px 'Fontin Sans', Fontin-Sans, sans-serif"; r.g.barchart(80, 25, 100, 320, data2, { stacked: true, colors: [<%= Session["vProgressColor"] %>,'#fff'] }); axis2 = r.g.axis(94, 325, 280, 0, 100, 10, 1); } } window.onload = function () { r.init(); }; This Java Script is not getting the new value from the session, it uses the old value when the page was loaded. How can I change the code to make sure the JS uses the latest session value.

    Read the article

< Previous Page | 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576  | Next Page >