Search Results

Search found 134806 results on 5393 pages for 'file server'.

Page 163/5393 | < Previous Page | 159 160 161 162 163 164 165 166 167 168 169 170  | Next Page >

  • copying folder and file permissions from one user to another after switching domains [closed]

    - by emptyspaces
    Please excuse the title, this was the best way I could think to describe this scenario without an entire paragraph. I am using C#. Currently I have a file server running windows server 2003 setup on a domain, we will call this oldDomain, and I have about 500 user accounts with various permissions on this server. Because of restrictions out of my control we are abandoning this domain and using another one that is more dominant within the organization, we will call this newDomain. All of the users that have accounts on oldDomain also have accounts on newDomain, but the usernames are completely different and there is no link between the two. What I am hoping to do is generate a list of all user accounts and this appropriate sid's from AD on the oldDomain, I already have this part done using dsquery and dsget. Then I will have someone go through and match all of the accounts from oldDomain to the correct username on newDomain. Ultimately leaving me with a list of sids from oldDomain and the appropriate username from newDomain. Now I am hoping to copy the file and folder permissions from the old user from oldDomain to the new user on newDomain once I join the server to newDomain. Can anyone tell me what the best way to copy permissions from the sid to the user on newDomain? There are a bunch of articles out there about copying permissions from user a to user b but I wanted to check and see what the recommended practice is here since there are a ton of directories.

    Read the article

  • Why is using OPENQUERY on a local server bad?

    - by Ziplin
    I'm writing a script that is supposed to run around a bunch of servers and select a bunch of data out of them, including the local server. The SQL needed to SELECT the data I need is pretty complicated, so I'm writing sort of an ad-hoc view, and using an OPENQUERY statement to get the data, so ultimately I end up looping over a statement like this: exec('INSERT INTO tabl SELECT * FROM OPENQUERY(@Server, @AdHocView)') However, I've heard that using OPENQUERY on the local server is frowned upon. Could someone elaborate as to why?

    Read the article

  • 2000 Server, User can't logon

    - by Mike I
    I hope you can help me. I recently upgraded a workstation at my office (to a whole new machine) and ran into a pretty serious problem. Friday until 5:00 PM, I could access my mail on 2000 Exchange server. When I shut the old workstation down and put in the new workstation, I tried to set up an account. When I put the server name in appropriate field and typed my username and hit check names, my username does not come up. So to troubleshoot, (It also is a SMB server) I try to logon to my file share. (My local credentials are the same as server credientials of user account) When I try to logon to share, I just get the Username/Password screen (Never had gotten that before since credentials are the same) Again, in troubleshooting mode, I try to log on to my user from another workstation. Still can't authenticate via my user. Every other user can authenticate and load up their shares/mailboxes. I have restored Exchange from the backup as of 3 days ago (Thursday) but the exact same issue is still there. I really do not understand what is wrong and what else I can do to troubleshoot. If anyone has some pointers for me, I will surely accept them. Thanks, Mike

    Read the article

  • Windows server 2008R2 routing with single NIC

    - by Fabian
    I'm trying to duplicate a Linux server configuration to a windows server 2008R2 box. Basicaly this linux server acts as a router, but it is doing its job with only 1 interface (1 NIC). Here is the network configuration in place (I cannot change it) : INTERNET <== Router (local ip = 194.168.0.3) <== linux Server (ip : 194.168.0.2). The router is configured with a DMZ to 194.168.0.2, and only allow this IP to connect to internet (Cannot change this router configuration). The linux server is configured with a default gateway to 194.168.0.3, with the option : "Act as router". All other computer on the lan have this configuration (given by DHCP) : IP range : 194.168.0.X MASK : 255.255.255.0 Default gateway : 194.168.0.2 And everything is working perfectly. I'm trying to reproduce this way of routing with only one NIC from a windows server 2008R2, but it seems that you cannnot do it with only one NIC (all exemples I see are refering to 2 NIC with 2 different network). Does someone have an idea how to achieved this in Windows server 2008R2 ? Tx you for your help ! Fabian.

    Read the article

  • Tables are not visible in SQL Server Management Studio but they are in Visual Studio using same acco

    - by Germ
    I'm experiencing a weird problem with a particular SQL login. When I connect to the server in Microsoft SQL Server Management Studio (2008) using this account, I cannot see any of the tables, stored procedures etc. that this account should have access to. When I connect to the same server within Visual Studio (2008) with the same account everything is there. I've also had a co-worker connect to the server using the same login and he's able to view everything as well. The strange thing is if I switch logins, I'm able to view objects that the other account has access to which indicates that there isn't a problem with MSSMS on my PC. Does anyone have any suggestions on how I can diagnose this problem? I've check to make sure I don't have any Table filters etc.

    Read the article

  • Remote Desktop to Server 2008 fails from one particular Win7 client

    - by Jesse McGrew
    I have a VPS running Windows Web Server 2008 R2. I'm able to connect using Remote Desktop from my home PC (Windows 7), personal laptop (Windows 7), and work laptop (Windows XP). However, I cannot connect from my work PC (Windows 7). I receive the error "The logon attempt failed" in the RDP client, and the server event log shows "An account failed to log on" with this explanation: Subject: Security ID: NULL SID Account Name: - Account Domain: - Logon ID: 0x0 Logon Type: 3 Account For Which Logon Failed: Security ID: NULL SID Account Name: username Account Domain: hostname Failure Information: Failure Reason: Unknown user name or bad password. Status: 0xc000006d Sub Status: 0xc0000064 Process Information: Caller Process ID: 0x0 Caller Process Name: - Network Information: Workstation Name: JESSE-PC Source Network Address: - Source Port: - Detailed Authentication Information: Logon Process: NtLmSsp Authentication Package: NTLM Transited Services: - Package Name (NTLM only): - Key Length: 0 I can connect from the offending work PC if I start up Windows XP Mode and use the RDP client inside that. The server is part of a domain but my account is local, so I'm logging in using a username of the form hostname\username. None of the clients are part of a domain. The server uses a self-signed certificate, and connecting from home I get a warning about that, but connecting from work I just get the logon error.

    Read the article

  • flowchart for debugging a slow/unresponsive server

    - by davidosomething
    So the server is slow: Roll back to the previous known working build - Success? Code problem - Fail? Go on. Ping ip address - Success? maybe a DNS problem, go on. - Fail? Server or connection problem, go on. Ping and tracert your domain.com from inside your network - previous success - fail: DNS problem - success? go on. - previous fail and: - Fail? Go on, could be you or network. - Success? Go on. Try it from outside your network (http://centralops.net/co/) - Fail? The server's network connection sucks. - Success? If inside network was fail, your network sucks. Check the server load: CPU/RAM usage. Is it overloaded? - Yes. Who's the culprit? Kill some processes/reboot. - No? Go on. what other steps should i add?

    Read the article

  • Getting file not found error with pdebuild

    - by user35042
    I am attempting to build a Debian package using pdebuild on my main development server (running Debian wheezy). Here is the command I run: pdebuild --pbuilder cowbuilder --buildresult .. \ --debbuildopts -i -- \ --basepath /var/cache/pbuilder/base-wheezy.cow \ --distribution wheezy --configfile /etc/pbuilder/wheezy This works on other servers, but on one server I get this output: I: using cowbuilder as pbuilder dpkg-buildpackage: source package libexample-orange-util-perl dpkg-buildpackage: source version 0.08 dpkg-buildpackage: source changed by John User <[email protected]> dpkg-source -i --before-build libexample-orange-util-perl fakeroot debian/rules clean dh clean dh_testdir dh_auto_clean dh_clean dpkg-source -i -b libexample-orange-util-perl dpkg-source: info: using source format `3.0 (native)' dpkg-source: info: building libexample-orange-util-perl in libexample-orange-util-perl_0.08.tar.gz dpkg-source: info: building libexample-orange-util-perl in libexample-orange-util-perl_0.08.dsc dpkg-genchanges -S >../libexample-orange-util-perl_0.08_source.changes dpkg-genchanges: including full source code in upload dpkg-source -i --after-build libexample-orange-util-perl dpkg-buildpackage: source only upload: Debian-native package File not found: ../libexample-orange-util-perl_0.08.dsc There is no file ../libexample-orange-util-perl_0.08.dsc, but on other build servers no such file is needed (it gets created by the package build). What is causing this "file not found" error?

    Read the article

  • "Error: Unknown error" when trying to start virtual machine from VMware server

    - by slhck
    Problem We are running VMware Server 2.0.0 build-116503 on a Ubuntu 10.04 LTS server. There is a virtual machine installed, running Lotus Domino on Windows Server 2003. Ever since a sudden power failure last week, the virtual machine won't properly start up. When I run the command: vmrun -T server -h https://127.0.0.1:8333/sdk -u root -p jk2x2208 start "[standard] lotus/test.vmx" … after 30 seconds it displays: Error: Unknown error That's about everything I get. I know the command is right, since that's what we've used all the time. This has happened last Saturday after a scheduled backup shutdown, and somehow I was able to start it again. This week, it happened again, and I can't get it back up. Occasionally, I also get: Error: Cannot connect to the virtual machine When I get this, and I run the start command, it seemingly works. Why is this so random? Which configuration could have been messed up? What I've tried / other info I already shut down VMware itself with /etc/init.d/vmware stop. This works. I tried to start VMware again with /etc/init.d/vmware start. It complains that it's "not configured", which is why I had to rm /etc/vmware/not_configured, and then try to start again. There have been no software updates on the machine, and no configuration changes

    Read the article

  • SQL Server Backup modes, and a huge log file

    - by Matt Dawdy
    Okay, I'm not a server administrator, a network guy, or a DBA. I'm merely a programmer helping out a small company. They have IT guy who isn't MS centric (most stuff is on Mac) and he and I are trying to figure out a solution here. We've got 1 main database. We run nightly full backups. I know they are full backups because I can take the latest file, or any of the daily backups, and go to a completely new machine and "restore" the backup to an empty database and our app runs perfectly fine off of this backup. The backups have grown from 60 MB to 250MB over 4 months. When running, then log file is 1.7 GB, and the data file is only 200-300 MB. Yes, recovery model is set to full. So, my question, after all of that, if we are keeping daily backups, and we don't have the need / aren't smart enough to roll the DB back to a certain time, if I change the recovery mode to simple, am I really losing anything? And, if I do change it to simple, will it completely dump the log file or at least reduce it way the hell down? And, will that make our database run faster? I know that it'll make my life easier when I copy a relatively recent backup to my local machine to do development and testing...

    Read the article

  • Installing Joomla on Windows Server 2008 with IIS 7.0

    - by Greg Zwaagstra
    Hi, I have been spending the past while trying to install Joomla on a server running Windows Server 2008. I have successfully installed PHP (using Microsoft's web tool for installing PHP with IIS) and MySQL and am now trying to run the browser-based installation. Everything comes up green, I fill in the appropriate information regarding the site name, MySQL information, etc. and no errors are thrown. However, when I get to the step that asks me to remove the installation directory, I am unable to do so as Windows states it is in use by another program (I cannot fathom how this is true). Also, there is no configuration.php file that is created so if I were to manage to delete this folder I have a feeling that there would be problems. I was thinking there was some kind of a permissions issue and have set the permissions for IIS_IUSRS to have read, write, and execute permissions for the entire folder that Joomla resides in but this has not helped. Any help in this matter is greatly appreciated. ;) Greg EDIT: I decided to try and manually install Joomla by manually editing the configuration.php file. This has worked great and now I am certain there is some kind of a permissions issue going on because I am able to do everything that involves the MySQL database (create an article, edit menu items, etc.), but anything that involves making changes to Joomla installation's directory does not work (install plugins, edit configuration settings using the Global Configuration menu within Joomla, etc.) I have granted IIS_IUSRS every permission except Full Control (reading on the Joomla! forums shows that this should be enough for everything to work). This is confusing to me and I am quite stuck on this problem. EDIT 2: The bizarre thing is that in the System Info under Directory Permissions, everything turns up as Writable but then whenever I try to actually use Joomla to, for example, edit the configuration.php file using the interface, it says it is unable to edit the file.

    Read the article

  • SQL Server Database In Single User Mode after Failover

    - by jlichauc
    Here is a weird situation we experienced with a SQL Server 2008 Database Mirroring Failover. We have a pair of mirrored databases running in high-availability mode and both the principal and mirror showed as synchronized. As part of some maintenance I triggered a manual failover of the principal to the mirror. However after the failover the principal was now in single-user mode instead of the expected "Principal/Synchronized" state we usually get. The database had been in multi-user mode on the previous principal before this had happened. We ended up stopping all applications, restarting the SQL Server instances, and executing "ALTER DATABASE ... SET MULTI_USER" to bring the database back to the expected "Principal/Synchronized" state in a multi-user mode. Question. Does anyone know where SQL Server stores information about whether a database should be in single-user mode or not? I'm wondering if there is some system database or table that has this setting recorded somewhere. In particular we had an incident once with the database on the original principal (the one I was failing over to) where when trying to detach the database it was put into single-user mode. I'm wondering if that setting is cached somewhere and is the reason that SQL Server put it back into single-user mode after a failover.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Command line scripts to restore the 4 system databases of MS SQL Server 2008

    - by ciscokid
    Hi there, can someone give me some advice on how to restore the 4 system databases (master, msdb, model, tempdb) of a sql server 2008 please? I've already done some testing myself (on restoring the master database) with the following commad line script as a result: ::set variables set dbname=master set dbdirectory=C:\Program Files\Microsoft SQL Server\MSSQL10.MSSQLSERVER\MSSQL\DATA title Restoring %dbname% database net stop mssqlserver cd C:\Program Files\Microsoft SQL Server\MSSQL10.MSSQLSERVER\MSSQL\Binn sqlservr -m sqlcmd -Slocalhost -E -Q "restore database master from disk='c:\master.bak' WITH REPLACE" net start mssqlserver pause After the execution of the 'sqlservr -m' command (used to start the server instance in single-user mode, which is only necessary when restoring the MASTER database), the script stops. So in order to execute the last 2 commands I need to separate the script into 2 smaller scripts, and run them one after the other. Does anyone has an idea on how I can merge them into one single script that runs completely without any interruption? I also want to restore the other 3 system databases using command line scripts like this one. Can someone please advice me how I need to go on? I've already noticed that restoring the temdb is not so easy, but there has to be a way... Looking forward to your advice!

    Read the article

  • Virtual Windows 2008 Server Activation with ESX

    - by Logman
    I had a decommissioned server (Dell PE2950) that we could still use, it had OEM Windows 2003 Std on it but wanted to use it as a new host with VMware ESX5 to put a couple legacy severs on it. I wiped it clean and maxed out the memory. But when I added the memory I noticed the product key sticker was a "WindowsServer08 Std 1-4cpu" product key, and it also had a Virtual Key. Not sure why it had Win2003 and not Win2008 from the start, but I would like to use that license if I can. The virtual host would stay on the same physical server, so there shouldn't be a problem with licensing... but I do not want to use Hyper-V unless I can not help it. I have installed ESX5 on the server, but I cannot get the Windows 2008 server to activate. The product key is hard to read, and I have checked the key quite a few times. But my question is... Is it because Hyper-V was not installed on the host? But I thought you could use the product key alone on a virtual host? Maybe because I am not using a Dell Windows 2008 disk but iso from MS directly via the Volumne Licensing site? EDIT: well, Im pretty sure I got the product key correct. If its not the product key, could the activation problem be because Im not using hyper-v or maybe the correct install dvd? EDIT2: maybe because I added 28GB of memory? Originally 4GB...

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Loads of memory in "standby" on Windows Server 2008 R2

    - by Jaap
    In our SharePoint farm, our Web Front End servers all have loads of memory in "standby" mode, meaning very little is available for our IIS worker process. We have 32 GB of RAM in each of the boxes, and standby memory will creep up to about 28 GB, whereas the IIS worker process only seems to be using about 2 GB. Also, we've seen the machine use the swap file extensively while this memory was in standby, so I am starting to think that this memory in standby mode is stopping IIS from using it, forcing it to swap to disk, causing more performance problems. I used SysInternals RamMap to indentify what is being kept in memory, and it was able to tell me that almost everything in standby memory is of type "Mapped File". When I sort the files listed under the file summary tab in RamMap by file size, the largest files (around a few hundred meg each) are IIS log files and SharePoint log files. I would like to understand which process is loading these files into standby memory and why they are not being released. When I do an iisreset, it does not release the memory. Any ideas? Thanks!

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • VPN on a ubuntu server limited to certain ips

    - by Hultner
    I got an server running Ubuntu Server 9.10 and I need access to it and other parts of my network sometimes when not at home. There's two places I need to access the VPN from. One of the places to an static IP and the other got an dynamic but with DynDNS setup so I can always get the current IP if I want to. Now when it comes to servers people call me kinda paranoid but security is always my number one priority and I never like to allow access to the server outside the network therefor I have two things I have to have on this VPN. One it shouldn't be accessiable from any other IP then these 2 and two it has to use a very secure key so it will be virtually impossible to bruteforce even from the said IP´s. I have no experience what so ever in setting up VPNs, I have used SSH tunneling but never an actuall VPN. So what would be the best, most stable, safest and performance effiecent way to set this up on a Ubuntu Server? Is it possible or should I just set up some kind of SSH Tunnel instead? Thanks on beforehand for answers.

    Read the article

  • CC.NET + SVN : Server certificate issue

    - by MSI
    I am trying to setup Continuous Integration in our office. Being a puny little developer I am facing this supposedly infamous problem: " Source control operation failed: svn: OPTIONS of 'https://trunkURL': Server certificate verification failed: issuer is not trusted" So I tried the following solution - Run CC.NET service (server running as win service) using a domain account (rather than default LOCAL SYSTEMS) and accept cert permanently using command prompt under that user by using svn log/list on the repo. Doesn't help :(. I am getting the following from my artifact/log files(or dashboard) ThoughtWorks.CruiseControl.Core.CruiseControlException: Source control operation failed: svn: OPTIONS of 'https://TrunkURL': Server certificate verification failed: issuer is not trusted (https://ServerAdd) . Process command: E:\(svn.exe Path) log https://TrunkURL -r "{2010-11-08T02:12:20Z}:{2010-11-08T02:13:21Z}" --verbose --xml --no-auth-cache --non-interactive at ThoughtWorks.CruiseControl.Core.Sourcecontrol.ProcessSourceControl.Execute(ProcessInfo processInfo) at ThoughtWorks.CruiseControl.Core.Sourcecontrol.Svn.GetModifications(IIntegrationResult from, IIntegrationResult to) at ThoughtWorks.CruiseControl.Core.Sourcecontrol.QuietPeriod.GetModificationsWithLogging(ISourceControl sc, IIntegrationResult from, IIntegrationResult to) at ThoughtWorks.CruiseControl.Core.Sourcecontrol.QuietPeriod.GetModifications(ISourceControl sourceControl, IIntegrationResult lastBuild, IIntegrationResult thisBuild) at ThoughtWorks.CruiseControl.Core.IntegrationRunner.GetModifications(IIntegrationResult from, IIntegrationResult to) at ThoughtWorks.CruiseControl.Core.IntegrationRunner.Integrate(IntegrationRequest request) We are using VisualSVN Server and CC.NET for this adventure. Tips, suggestions will be highly appreciated. Thanks

    Read the article

  • Proper web server setup

    - by DMin
    I just got myself a slicehost basic slice to play around with so I can learn how to setup web-servers. I have Ubuntu 10.04.2 installed on the server. I was able to successfully get the server up and running from scratch, these were the things I did - following this tutorial. I know this is probably just a starters tutorial, so, I was wondering if you guys can tell me what you like to do while setting up production servers. These are the steps that were followed : Update and Upgrade Ubuntu sudo apt-get install apache2 php5-mysql libapache2-mod-php5 mysql-server Backup a copy of and edit apache2.conf Set : 'ServerTokens Full' to 'ServerTokens Prod''ServerSignature On' to 'ServerSignature Off' Backup php.ini and then Change “expose_php = On” to “expose_php = Off” Restart Apache Install Shorewall firewall Configure Shorewall to only accept HTTP and SSH connections(in the rules file) Enable shorewall on startup Add the website to the server : sudo usermod -g www-data root sudo chown -R www-data:www-data /var/www sudo chmod -R 775 /var/www I want make this CommunityWiki but can't seem to find the option to do it. Please feel free to add any feedback on the processes and things I am doing right/wrong. Much appriciated, thanks! :)

    Read the article

  • What kind of server attacks should i be aware of nowadays

    - by Saif Bechan
    I am recently running a web server, and there is a lot of information online, but it can all be a little confusing. I recently opened my logwatch logs and saw that i get attacked a lot by all sorts of bots. Now I am interested in a list with things I definitely should be aware of nowadays, and possible ways to prevent them. I have read stories about server crashed by floods, crashed by email, and all sorts of crazy stuff. Thing I already did: I have recently blocked all my ports, except for the http and email ports. I disabled IPv6, this was giving me a lot of named errors I have turned on spam DNS blackhole lists to fight spam - sbl.spamhaus.org; - zen.spamhaus.org; - b.barracudacentral.org; I installed and configured mod_security2 on apache There is no remote access possible to my databases That is all i did so far, further I am not aware of any other threats. I want to know if the following things have to be protects. Can I be flooded by emails. How can i prevent this Can there be a break in or flood of my databses Are there things like http floods or whatever Are there any other things i should know before i go public with my server I also want to know if there is some kind of checklist with must-have security protections. I know the OWASP list for writing good web applications, is there something for configuring a server.

    Read the article

  • Access server using IP on another interface

    - by Markos
    I am using Windows Server 2012 instead of a router for my home network. Currently I am using RRAS and computers from local network can access Internet correctly. Here is a map of the current setup: [PC1] ---| |---- (lan ip)[Server](wan ip)--> internet [PC2] ---| I have applications running on Server, such as IIS and others. All can be accessed from internet using wan ip and from lan using lan ip. I have a domain, lets say its my-domain.com, which is resolved to my wan ip. What I want is to enable my LAN computers to be able to connect to services on my server using the very same address as internet users: eg http://my-domain.com/. However this does not work for my lan computers. What I understand is that I need to set up some kind of loopback route in a way that packets comming to LAN interface get routed to WAN interface. But I haven't found how to achieve this (in fact, I don't know WHAT to search for). Feel free to ask for additional informations and I will try to update the question.

    Read the article

< Previous Page | 159 160 161 162 163 164 165 166 167 168 169 170  | Next Page >