Search Results

Search found 75615 results on 3025 pages for 'www data'.

Page 1665/3025 | < Previous Page | 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672  | Next Page >

• who can tell me the rules of extra 100% bonus for swtor credits in swtor2credits?

  - by user46860

  During Father's Day, you can buy swtor credits with 50% OFF! swtor2credits.com offer swtor players with extra 100% bonus for swtor credits, when you spend the same money as before, you can get double swtor credits! Rules for extra 100% bonus for swtor credits. 1. From June 16 to June 18, 2014, 02:00-03:00 a.m. GMT, is the ONLY valid time for getting double swtor credits at swtor2credits. 2. The total sum of your order is valued $10 at most. Beyond this money, please apply discount code you know to save extra money. 3. Everyone has only one chance to get double swtor credits at swtor2credits during our promotion. 4. As long as your order has used extra discount code or voucher, you lose the chance to get exclusive 100% bonus. Please read these activities rules carefully, and don't miss the time! Like Swtor2credits Facebook to Gain Free Cash Coupon, Up to $16 Giveaways for Swtor Credits! 1. Share our facebook posts in your timeline. 2. Leave your preciously constructive suggestion on our facebook page. 3. Share your amazing swtor gaming screenshots on our page. Time: May 29, 2014 to June 12.2014.GMT. https://www.facebook.com/pages/swtor2creditscom/493389160685307 Cheap swtor credits in swtor2credits.com.

  Read the article

• Next Generation Traffic

  Web 2.0 changes the whole known scenario of how we see and use the web. It provides the ability to the user to create and manipulate data. Web 2.0 creates a brand new internet.

  Read the article

• Use .htaccess to block *All* access to specific folders.

  - by Urda

  I am not sure how to do this, but I want to block all access to a specific set of folders on my web server. Say secret01 and secret 02... homeDir |- data |- www | |- .htaccess (file) | |- images | |- js | |- secret01 | |- secret02 | |... |... What rule(s) do I need to add to my root .htaccess file to do this? I want all access from the web blocked from going into these folders, period. Only way one could get to them would be over SFTP or SSH. So what rule am I looking for? I am preferably looking for a one-liner so I can add more folders or move it to another site down the road. I really would prefer if the rule could be placed in the .htaccess root file so I don't have to jump all over the place to lock and unlock folders.

  Read the article

• Accessing SVN Repository on external drive

  - by Stephen

  I've installed SVN on my Raspberry PI and configured it to access the repository on an external hard drive. In /etc/fstab, I've have the following: //192.168.1.12/SHARE/repos /media/repos cifs sec=ntlm,username=Guest,password=,_netdev,dir_mode=0777,file_mode=0777 0 0 This mounts with no issues. When I go to add a project to the repository using the following command: sudo svn import mywebsite/ file://media/repos/mainrepository/mywebsite/ -m "Initial Upload" I get the following error: svn: E170000: Unable to connect to a repository at URL 'file://media/repos/mainrepository/mywebsite' svn: E170000: Unable to open an ra_local session to URL svn: E170000: Local URL 'file://media/repos/mainrepository/mywebsite' contains unsupported hostname The only thing I think maybe causing the issue is the file settings: drwxrwxrwx 2 root root 0 Jun 11 2009 repos As you can see the owner is root, I think it needs to be www-data, but for some reason I can't change it. Any help appreciated.

  Read the article

• IE 9:Release

  - by xamlnotes

  Yippie: IE 9s coming out March 14!: http://windowsteamblog.com/ie/b/ie/archive/2011/03/09/a-more-beautiful-web-launches-on-march-14th.aspx For you guys that love other browsers that’s ok. Personally I love IE for many reasons such as ease of use and stability.  I am cranked up to see what IE 9 does as it was retooled from the start. So this one should be big. Also, its bringing HTML 5 support now so we can have much richer applications. Its about time that HTML was revved to move from the old text like stuff to a better model. More info: http://windowsteamblog.com/ie/b/ie/archive/tags/ie9/ Some glimpses here: http://windows.microsoft.com/en-US/internet-explorer/products/ie-9/features and http://www.beautyoftheweb.com/#/highlights/all-around-fast   Looks like it will be much faster (with hardware support now) in many areas.  Better startup times and install times are hot on my list of favorites too. Plus they retooled the UI in many places too.  The UI looks a lot cleaner now: http://windows.microsoft.com/en-US/internet-explorer/products/ie-9/features/focused-on-your-websites Plus theres tons more like changes in tab pages, a notfication bar, pinned sites and so forth. Plus theres cool integration with Windows 7 also.

  Read the article

• Torvalds' quote about good programmer

  - by beyeran

  Accidentally I've stumbled upon the following quote by Linus Torvalds: "Bad programmers worry about the code. Good programmers worry about data structures and their relationships." I've thought about it for the last few days and I'm still confused (which is probably not a good sign), hence I wanted to discuss the following: What interpretation of this possible/makes sense? What can be applied/learned from it?

  Read the article

• Will we be penalized for having multiple external links to the same site?

  - by merk

  There seem to be conflicting answers on this question. The most relevant ones seem to be at least a year or two old, so I thought it would be worth re-asking this question. My gut says it's ok, because there are plenty of sites out there that do this already. Every major retailer site usually has links to the manufacturer of whatever item they are selling. go to www.newegg.com and they have hundreds of links to the same site since they sell multiple items from the same brand. Our site allows people to list a specific genre of items for sale (not porn - i'm just keeping it generic since I'm not trying to advertise) and on each item listing page, we have a link back to their website if they want. Our SEO guy is saying this is really bad and google is going to treat us as a link farm. My gut says when we have to start limiting user useful features to our site to boost our ranking, then something is wrong. Or start jumping through hoops by trying to hide text using javascript etc Some clients are only selling 1 to a handful of items, while a couple of our bigger clients have hundreds of items listed so will have hundreds of pages that link back to their site. I should also mention, there will be a handful of pages with the bigger clients where it may appear they have duplicate pages, because they will be selling 2 or 3 of the same item, and the only difference in the content of the page might just be a stock #. The majority of the pages though will have unique content. So - will we be penalized in some way for having anywhere from a handful to a few hundred pages that all point to the same link? If we are penalized, what's the suggested way to handle this? We still want to give users the option to go to the clients site, and we would still like to give a link back to the clients site to help their own SE rankings.

  Read the article

• Trouble getting PHP, Apache, and Zend talking to eachother (localhost)

  - by Joel

  Hi guys, I've searched through several other questions, but haven't found my solution. THe main reason is that I'm not even sure if I have all these things properly installed. I have a hosting account, and have always just deployed everything into the internets, but I'm finally trying to figure out how to get my desktop set up right for learning Zend Framework. I have Apache Server 2.2, PHP, And Zend Framework installed. I'm trying to do this tutorial: http://akrabat.com/wp-content/uploads/Getting-Started-with-Zend-Framework.pdf The problem is when I click on the link: http://localhost/zf-tutorial/public I get an Error 404. If I type in http://www.localhost I get "It Works!" in the browser. I'm thinking this means I have Apache installed correctly, but am not pointing correctly to the Zend tutorial? Thanks for any help!

  Read the article

• Online SQL course [closed]

  - by Sualeh Fatehi

  Does anyone know of a free online SQL source that allows you to practice SQL online without installing a database? Sort of like Code Academy? I am looking to start teaching SQL to a remote audience, and I want to be able to set up a schema and some data, and have the students run SQL against my schema, and practice. I also want a way to set up some exercises for them. In short, a Code Academy kind of environment for SQL.

  Read the article

• Remote desktop connection over internet without port forwarding?

  - by hellbell.myopenid.com

  Hello, let's say that we have this situation. I want to remote desktop connection to my friend over the internet, but I don't have premission for port forwarding on the router, and my friend also can't configure his router. So the question is how to connect to computer without port forwarding, I know that is out there some programs like teamviewer, or some else that solve that task, but what I looking for is the some free site that can make "bridge" between are two computer, or is it possible to install on computer some program that simulate virtual router or something like this http://www.youtube.com/watch?v=SIof7kFTgJE .... I need this cause I have my own simple remote desktop connection program, but I can't connect to other computer outside network cause don't have premission to configure router :( any comment, link, advice, or tutorials will be very helpful :)

  Read the article

• Creating a Simple ASP.NET Report with Export to Excel

  In this article you will learn how to create a simple ASP.NET report using Web Forms, C#, and a View Model class rather than drag and drop controls, resulting in very clean and understandable HTML. Then, you'll learn how to add Export to Excel functionality, allowing users to export the data in Excel format and save the file with a default filename of your choosing (as opposed to Report.aspx, for instance).

  Read the article

• why page is automatically redirecting to some other sites

  - by raj

  In my browser (Firefox 10.0.7) the page is automatically redirect to some other sites without clicking any link. If I enter the superuser.com url after pressing Enter button, It redirect to some other sites. sometimes while refreshing also the page is redirect to some other site. It's redirecting to this sites http://result.seenfind.com/ncp/Default.aspx?term=gatlinburg%20cabin&u=1000670913 http://search.cpvee.com/search.php?q=gatlinburg+cabin&y=&f=2168&s= http://www.insidecelebritygossip.com/ I cleared all history and all but still same problem. I am using CentOS 6.3

  Read the article

• How should a small team using multiple OS's deploy over github?

  - by Toby

  We have a small development team that have recently moved to using github to host our projects. The team consists of three developers, 2 on Windows and 1 on Mac. I am currently researching the best way to deploy applications to our Linux servers (dev and production). Capistrano running locally would be ideal but from what I read this won't work for Windows machines. It looks like the best way is to use a post-receive hook in github, I can see how this would work for auto deploying to dev, but I don't see how we could then deploy to live. I have found paid projects like http://www.deployhq.com/ but it feels like something that a quick bit of code should be able to do for free, I just can't seem to get myself pointed in the right direction! I was wondering what would be considered best practice for small team deployment involving multiple local OS's and github.

  Read the article

• Trouble with collision detection in XNA?

  - by Lewis Wilcock

  I'm trying to loop through an list of enemies (enemyList) and then any that have intersected the rectangle belonging to the box object (Which doesn't move), declare there IsAlive bool as false. Then another part of the code removes any enemies that have the IsAlive bool as false. The problem im having is getting access to the variable that holds the Rectangle (named boundingBox) of the enemy. When this is in a foreach loop it works fine, as the enemy class is declared within the foreach. However, there are issues in using the foreach as it removes more than one of the enemies at once (Usually at positions 0 and 2, 1 and 3, etc...). I was wondering the best way to declare the enemy class, without it actually creating new instances of the class? Heres the code I currently have: if (keyboardState.IsKeyDown(Keys.Q) && oldKeyState.IsKeyUp(Keys.Q)) { enemyList.Add(new enemy(textureList.ElementAt(randText), new Vector2(250, 250), graphics)); } //foreach (enemy enemy in enemyList) //{ for (int i = 0; i < enemyList.Count; i++) { if (***enemy.boundingBox***.Intersects(theDefence.boxRectangle)) { enemyList[i].IsDead = true; i++; } } //} for(int j = enemyList.Count - 1; j >= 0; j--) { if(enemyList[j].IsDead) enemyList.RemoveAt(j); } (The enemy.boundingBox is the variables I can't get access too). This is a complete copy of the code (Zipped) If it helps: https://www.dropbox.com/s/ih52k4e21g98j3k/Collision%20tests.rar I managed to find the issue. Changed enemy.boundingBox to enemyList[i].boundingBox. Collision works now! Thanks for any help!

  Read the article

• Using Drupal to build a directory listing? [on hold]

  - by Jim

  I am trying to create a form inside Drupal that will allow me to create a directory similar to this diagram: http://i.imgur.com/EtChBbG.jpg I tried looking into HTML tables but it is too basic for what I'm trying to do. How do I create a directory that can archive data in an alphabetical ordering? It also has to be able to sort by letters and other categories. Does anyone have an idea of how I should go about doing this? Thanks!

  Read the article

• How to perform a nested mount when using chroot?

  - by user55542

  Note that this question is prompted by the circumstances detailed by me (as Xl1NntniNH7F) in http://www.linuxquestions.org/questions/linux-desktop-74/boot-failure-upon-updating-e2fsprogs-in-ubuntu-10-10-a-947328/. Thus if you could address the underlying cause of the boot failure, I would very much appreciate it. I'm trying to replicate the environment in my ubuntu installation (where the home folder is on a separate partition) in order to run make uninstall. I'm using a live cd. How to mount a dir in one partition (sda2, mounted in ubuntu as the home folder) into a directory on another mounted partition (sda3)? I did chroot /mnt/sda2 but I don't know how to mount sda3 to /home, and my various attempts didn't work. As I am unfamiliar with chroot, my approach could be wrong, so it would be great if you could suggest what I should do, given my circumstances.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Thinking about open-sourcing quiz project [closed]

  - by user72727

  I was thinking about starting an open source project. I have a few projects that might work ok as an open project but thought I might dip my toe into the water with a simple quiz project. The idea is you can add questions to a quiz, arrange questions by topic, difficulty or location. Users would hopefully get an interesting quiz, tuned to their ability. At the end they'd get a score and hopefully they might provide either some feedback on the questions or even supply a few questions of their own. I couldn't see a similar project (fame's last words). I have a basic version of the project that gives the user a bunch of questions to answer in 10 minutes. It doesn't currently group the questions into topics, and no feedback is taken. I've also been told the graphical questions don't work on Ipads for some reason. Would this be a suitable project to go open source? I did find various quiz's out there but all seemed rather narrowly focused. I really wanted something that could cover any type of question on any type of subject. I prefer to keep the questions in MySQL but I could see how this might make it more difficult for others to get on board - should I move to data files? How do I proceed? http://www.checkmypages.com/numbers

  Read the article

• How to rewrite index.php (and other valid default files) to the document root using mod_rewrite?

  - by TMG

  Hello, I would like to redirect index.php, as well as any other valid default file (e.g. index.html, index.asp, etc.) to the document root (which contains index.php) with something like this: RewriteRule ^index\.(php|htm|html|asp|cfm|shtml|shtm)/?$ / [NC,L] However, this is of course giving me an infinite redirect loop. What's the right way to do this? If possible, I'd like to have this work in both the development and production environment, so I don't want to specify an explicit url like http://www.mysite.com/ as the target. Thanks!

  Read the article

• Should I use multiple column primary keys or add a new column?

  - by Covar

  My current database design makes use of a multiple column primary key to use existing data (that would be unique anyway) instead of creating an additional column assigning each entry an arbitrary key. I know that this is allowed, but was wondering if this is a practice that I might want to use cautiously and possibly avoid (much like goto in C). So what are some of the disadvantages I might see in this approach or reasons I might want a single column key?

  Read the article

• Moving cpanel backup of magento site to VPS

  - by user2564024

  I was having my site in shared hosting, I took the entire backup, its structure is like addons homedir mysql resellerpackages suspendinfo bandwidth homedir_paths mysql.sql sds userconfig counters httpfiles mysql-timestamps sds2 userdata cp locale nobodyfiles shadow va cron logaholic pds shell vad digestshadow logs proftpdpasswd ssl version dnszones meta psql sslcerts vf domainkeys mm quota ssldomain fp mma resellerconfig sslkeys has_sslstorage mms resellerfeatures suspended Now I have subscribed to vps, I have copied the files inside homedir/public_html to var/www/html of my new hosting, but am seeing the following error when I view it browser, There has been an error processing your request Exception printing is disabled by default for security reasons. Error log record number: 259343920016 I have just created database with name magenhto inside mysql. Previously I had cpanel and used one click installer. Hence am not aware of how to use that data inside mysql to this new system and are there any more changes.

  Read the article

• Oracle Weblogic 12c for New Projects–Webcast November 7th 2013

  - by JuergenKress

  Fast-growing organizations need to stay agile in the face of changing customer, business or market requirements. Oracle WebLogic Server 12c is the industry's best application server platform that allows you to quickly develop and deploy reliable, secure, scalable and manageable enterprise Java EE applications. WebLogic Server Java EE applications are based on standardized, modular components. WebLogic Server provides a complete set of services for those modules and handles many details of application behavior automatically, without requiring programming. New project applications are created by Java programmers, Web designers, and application assemblers. Programmers and designers create modules that implement the business and presentation logic for the application. Application assemblers assemble the modules into applications that are ready to deploy on WebLogic Server. Build and run high-performance enterprise applications and services with Oracle WebLogic Server 12c, available in three editions to meet the needs of traditional and cloud IT environments. Join us, in this webcast, as we will show you how WebLogic Server 12c helps you building and deploying enterprise Java EE applications with support for new features for lowering cost of operations, improving performance, enhancing scalability. Agenda Oracle WebLogic Server Introduction Application Development on WebLogic Using Java EE Overview of the Application Deployment Process Monitoring Application Performance Q&A November 07th, 2013   9am UTC/11am EET REGISTER NOW WebLogic Partner Community For regular information become a member in the WebLogic Partner Community please visit: http://www.oracle.com/partners/goto/wls-emea ( OPN account required). If you need support with your account please contact the Oracle Partner Business Center. Blog Twitter LinkedIn Mix Forum Wiki Technorati Tags: education,WebLogic,WebLogic Community,Oracle,OPN,Jürgen Kress

  Read the article

• Windows 7 - add item to 'New' context menu

  - by Tingholm

  I've installed Access 2010 but have some software that can only handle the old .mdb files. When I right click an empty space in a folder and select 'New', I would like to create an .mdb file instead of .accdb. I've managed to remove the "New Access Database" that created a new .accdb file, but I can't find how to create a context menu item to make a new .mdb file. I've tried: Windows 7 - Add an item to 'new' context menu http://www.sevenforums.com/tutorials/22001-new-context-menu-edit-desktop.html However I've had no luck, nothing appears in the 'New' menu. Any ideas?

  Read the article

• Open Terminal Here, as Root (OS X)

  - by cwd

  There is a pretty awesome applescript called "Open Terminal Here" ( http://www.entropy.ch/software/applescript/ ) which you can add to your finder's toolbar and click when you want to launch a terminal console which is set to that directory. Sometimes I need to be root, and so I end up starting terminal, doing something like sudo -i and then I have to change back to the previous directory because the sudo command is landing me in /var/root. I'm using sudo -i because I like it to load things like aliases / the bash profile. The script is applescript, and here's the important part of how it works: ... set cmd to "cd " & quoted form of the_path & " && echo $'\\ec'" ... tell application "Terminal" activate do script with command cmd How do I get this to load as root?

  Read the article

• How to exclude IP from htaccess domain redirect

  - by ijujym

  I'm trying to write a custom redirect rule for some testing purposes on 2 domains with exactly same site. The code I am using is: RewriteEngine on RewriteCond %{REMOTE_ADDR} !^1\.2\.3\.4$ RewriteCond %{HTTP_HOST} ^.*site1.com [NC] RewriteRule ^(.*)$ http://www.site2.com/$1 [R=301,L] What I want is to redirect all requests for site1 to site2 except for requests from IP address 1.2.3.4. But currently requests from that IP are also being redirected to site2. Is there something I've missed in settings? ( note: both domains are on the same shared hosting account )

  Read the article

< Previous Page | 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672  | Next Page >