Search Results

Search found 17867 results on 715 pages for 'delete row'.

Page 177/715 | < Previous Page | 173 174 175 176 177 178 179 180 181 182 183 184  | Next Page >

  • Merging multiple versions of same excel spreadsheet

    - by GrinReaper
    So here's the situation: I have multiple versions of the same spreadsheet-- each one has the exact same row and column labels. The difference between any two given spreadsheets is that data in one spreadsheet shouldn't be in the other (but sometimes it might.) Is there anyway to merge all of them into a "master copy" (or just a blank version) of the spreadsheet? (basically, using the data from various versions of that worksheet to fill out the main one) Copy-pasting is extremely tedious, and doesn't allow me to copy blocks of rows IF the row numbering is non-contiguous. (For example, Rows 1, 2, 3, 6 are in a block, but row 4 and 5 just don't exist.) Ideas? Googling hasn't turned up anything that seemed directly relevant to this problem.

    Read the article

  • Grant users access to mysql with a dash in the database name

    - by Matt
    Unfortunately, I have a database name with a dash in it. How do I grant access to that database as mysql reports a syntax error. e.g. grant select,insert,update,delete on astpp.* to 'portal'@'localhost' identified by 'Ab7g12Xh35' with grant option; works, but grant select,insert,update,delete on astpp-eth01.* to 'portal'@'localhost' identified by 'Ab7g12Xh35' with grant option; Does not. Neither does: grant select,insert,update,delete on 'astpp-eth01'.* to 'portal'@'localhost' identified by 'Ab7g12Xh35' with grant option;

    Read the article

  • conditional formatting for subsequent rows or columns

    - by Trailokya Saikia
    I have data in a range of cells (say six columns and one hundred rows). The first four column contains data and the sixth column has a limiting value. For data in every row the limiting value is different. I have one hundred such rows. I am successfully using Conditional formatting (e.g. cells containing data less than limiting value in first five columns are made red) for 1st row. But how to copy this conditional formatting so that it is applicable for entire hundred rows with respective limiting values. I tried with format painter. But it retains the same source cell (here limiting value) for the purpose of conditional formatting in second and subsequent rows. So, now I am required to use conditional formatting for each row separately s

    Read the article

  • How to resolve "HTTP/1.1 403 Forbidden" errors from iCal/CalDAV server after upgrade to Snow Leopard Server?

    - by morgant
    We recently upgraded our Open Directory Master & Replica to Mac OS X 10.6.4 Snow Leopard Server. We had a mismatched server FQDN & LDAP Search Base/Kerberos Realm, so we exported all users & groups, created the new Open Directory Master w/matching FQDN & Search Base/Realm, reimported users & groups, and re-bound all servers & workstations to the new OD Master. At the same time as all of this, we upgraded our iCal/CalDAV server to Mac OS X 10.6.4 Snow Leopard Server. Ever since doing so, we've seen the following issues with our iCal/CalDAV server and iCal clients on both Mac OS X 10.5 Leopard & Mac OS X 10.6: If a user attempts to move or delete an event (single or repeating) that was created prior to the upgrade to 10.6 Server, they get the following error: Access to "blah" in "blah" in account "blah" is not permitted. The server responded: "HTTP/1.1 403 Forbidden" to operation CalDAVWriteEntityQueueableOperation. New users added to the directory get the following error when attempting to add their account to in iCal's preferences: The user "blah" has no configured pricipals. Confirm with your network administrator that your account has at least one CalDAV principal configured. Interestingly, we've since discovered that users seem to be able to delete individual events from an old repeating event without error, but that's a massive amount of work to get rid of a repeating event. I will note that we have not yet added an SRV record in DNS as instructed on page 19 of iCal_Server_Admin_v10.6.pdf. Further Investigation: In this particular case, a user is attempting to decline repeating events created prior to the upgrade to Snow Leopard Server. Granting the user full write access with sudo calendarserver_manage_principals --add-write-proxy users:user1 users:user2 (which did work) doesn't allow deletion of the events. Still get the usual error: Access to "blah blah" in "blah blah" in account "blah blah" is not permitted. The server responded: "HTTP/1.1 403 Forbidden" to operation CalDAVWriteEntityQueueableOperation. The error that shows up in /var/log/caldavd/error.log on the iCal Server when attempting to delete one of the events is: 2011-03-17 15:14:30-0400 [-] [caldav-8009] [PooledMemCacheProtocol,client] [twistedcaldav.extensions#info] PUT /calendars/__uids__/XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX/calendar/XXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX.ics HTTP/1.1 2011-03-17 15:14:30-0400 [-] [caldav-8009] [PooledMemCacheProtocol,client] [twistedcaldav.scheduling.implicit#error] Cannot change ORGANIZER: UID:XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX And the error in /var/log/system.log on the client is: Mar 17 15:14:30 192-168-21-169-dhcp iCal[33509]: CalDAV CalDAVWriteEntityQueueableOperation failed: status 'HTTP/1.1 403 Forbidden' request:\n\nBEGIN:VCALENDAR^M\nVERSION:2.0^M\nPRODID:-//Apple Inc.//iCal 3.0//EN^M\nCALSCALE:GREGORIAN^M\nBEGIN:VTIMEZONE^M\nTZID:US/Eastern^M\nBEGIN:DAYLIGHT^M\nTZOFFSETFROM:-0500^M\nTZOFFSETTO:-0400^M\nDTSTART:20070311T020000^M\nRRULE:FREQ=YEARLY;BYMONTH=3;BYDAY=2SU^M\nTZNAME:EDT^M\nEND:DAYLIGHT^M\nBEGIN:STANDARD^M\nTZOFFSETFROM:-0400^M\nTZOFFSETTO:-0500^M\nDTSTART:20071104T020000^M\nRRULE:FREQ=YEARLY;BYMONTH=11;BYDAY=1SU^M\nTZNAME:EST^M\nEND:STANDARD^M\nEND:VTIMEZONE^M\nBEGIN:VEVENT^M\nSEQUENCE:5^M\nDTSTART;TZID=US/Eastern:20090117T094500^M\nDTSTAMP:20081227T143043Z^M\nSUMMARY:blah blah^M\nATTENDEE;CN="First Last";CUTYPE=INDIVIDUAL;ROLE=REQ-PARTICIPANT:urn:uuid^M\n :XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX^M\nATTENDEE;CN="First Last";CUTYPE=INDIVIDUAL;PARTSTAT=ACCEPTED:mailto:user@d^M\n omain.tld^M\nEXDATE;TZID=US/Eastern:20110319T094500^M\nDTEND;TZID=US/Eastern:20090117T183000^M\nRRULE:FREQ=WEEKLY;INTERVAL=1^M\nTRANSP:OPAQUE^M\nUID:XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX^M\nORGANIZER;CN="First Last":mailto:[email protected]^M\nX-WR-ITIPSTATUSML:UNCLEAN^M\nCREATED:20110317T191348Z^M\nEND:VEVENT^M\nEND:VCALENDAR^M\n\n\n... response:\nHTTP/1.1 403 Forbidden^M\nDate: Thu, 17 Mar 2011 19:14:30 GMT^M\nDav: 1, access-control, calendar-access, calendar-schedule, calendar-auto-schedule, calendar-availability, inbox-availability, calendar-proxy, calendarserver-private-events, calendarserver-private-comments, calendarserver-principal-property-search^M\nContent-Type: text/xml^M\nContent-Length: 134^M\nServer: Twisted/8.2.0 TwistedWeb/8.2.0 TwistedCalDAV/2.5 (iCal Server v12.56.21)^M\n^M\n<?xml version='1.0' encoding='UTF-8'?><error xmlns='DAV:'>^M\n <valid-attendee-change xmlns='urn:ietf:params:xml:ns:caldav'/>^M\n</error> One thing I have noticed, and I'm not sure if this has any real effect is that in many of these pre-Snow Leopard Server migration events, the ORGANIZER is specified like the following: ORGANIZER;CN=First Last:mailto:[email protected] But newer ones are more like one of the two following: ORGANIZER;CN=First Last;[email protected];SCHEDULE-STATUS=1 ORGANIZER;CN=First Last;[email protected]:urn:uuid:XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX iCal_Server_Admin_v10.6.pdf notes that the ".db.sqlite" files are completely disposable, they're merely a performance cache and are re-built on the fly, so are safe to delete. I did delete the one for the organizer's calendars and it took longer to process the attempted event delete while it rebuilt the database, but still errored out in the end. FWIW the error is thrown by this code: https://trac.calendarserver.org/browser/CalendarServer/trunk/twistedcaldav/scheduling/implicit.py Any further suggestions? I see lots of questions about this in my Google searches, but not solutions and this is a widespread problem on our iCal Server. Now, we mostly try to get users to ignore them (hence the amount of time this question has been open), but every now and then I dig in deeper trying to find the culprit and/or solution.

    Read the article

  • Cannot seem to disable ability to view temporary internet files via group policy

    - by user162707
    Windows XP Pro SP3, IE8 (8.0.6001.18702), within local gpedit.msc I did the below: User Config/Admin Temp/Windows Comp/IE enabled: disable changing temporary internet file settings User Config/Admin Temp/Windows Comp/IE/Delete Browsing History enabled all (11 items) However there is a loophole that lets me still wipe history & other files via: Tools, Internet Options, Browsing History, Settings, View Objects, delete everything, hit up arrow, go to History (hidden folders has to be on), delete everything Only way around this I can see is to disable General Internet Options Page via group policy, setup NTFS folder restrictions on that temp internet files (worried about adverse affects like not being able to store them), or further grind-down group policy somewhere else to prevent deleting files. Just odd group policy wouldn't have a settings to simply disable the Browser History Settings button (as it further shows the location which a user could just go to). So just curious if someone can confirm maybe this is simply not available in group policy & their suggested action

    Read the article

  • Steps to take when technical staff leave

    - by Tom O'Connor
    How do you handle the departure process when privileged or technical staff resign / get fired? Do you have a checklist of things to do to ensure the continuing operation / security of the company's infrastructure? I'm trying to come up with a nice canonical list of things that my colleagues should do when I leave (I resigned a week ago, so I've got a month to tidy up and GTFO). So far I've got: Escort them off the premises Delete their email Inbox (set all mail to forward to a catch-all) Delete their SSH keys on server(s) Delete their mysql user account(s) ... So, what's next. What have I forgotten to mention, or might be similarly useful? (endnote: Why is this off-topic? I'm a systems administrator, and this concerns continuing business security, this is definitely on-topic.)

    Read the article

  • How to remove ActiveX Add on from IE 7 (normal method does not work)

    - by James
    Hi, Does anybody know how to remove an ActiveX control from Internet Explorer 7.0 ? I had been deleting and adding this control numerous times using the built in delete button in Tools, Manage Add-ons, Enable or Disable. This is required for me to test a downloader ActiveX used for a website. It had always shown up in the "Downloaded ActiveX Controls (32 bit) section of the drop down which activates the delete button. However, all of a sudden it now appears under "Add ons that have been used by Internet Explorer" and I cannot delete it from there. The "in folder" column says it's in the C:\WINDOWS\Downloaded Program Files folder... But it does not appear to be there either... Thanks, James

    Read the article

  • How do I extract excel data from multiple worksheets and put into one sheet?

    - by user167210
    In a workbook I have 7 sheets(Totals and then Mon to Sat),I want to extract rows which have the word "CHEQ" in its cell (this is a dropdown list with two options-CHEQ/PAID)from all sheets. On my front sheet I used this formula: =IF(ROWS(A$13:A13)>$C$10,"",INDEX(Monday!A$3:A$62,SMALL(IF(Monday[Paid]=$A$10,ROW(Monday[Paid])-ROW(Monday!$I$3)+1),ROWS(A$13:A13)))) This formula works fine for one worksheet (eg. Monday) but is it possible to show the extracted rows from all 6 sheets on the front page? I only have Excel NOT Access. These are the 12 headers on row A12 Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted The exported data appears like this (this just an example): Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted 12 Robbs 1244 Ren 11/10 10% 5 CHEQ 0 0 No 15 Jones 7784 Ren 12/10 15% 1 CHEQ 0 0 No 18 Doese 1184 Ren 12/11 12% 1 CHEQ 0 0 No Any ideas on what to do to this formula? I am using Excel 2010.

    Read the article

  • How to "ignore" username and password prompt in net use

    - by Mattisdada
    I have at the moment a logon.cmd script, that I'm using to map network drives to the users profile. It looks like this: ::Onboarding net use m: /delete net use m: \\BOB\onboarding ::Bookings net use n: /delete net use n: \\BOB\bookings ::Accounts net use j: /delete net use j: \\BOB\accounts It works fine up until it gets up to a folder that the current user cannot access, it then asks for a username and password instead of erroring and continuing. Notes: This very script used to work on another Samba PDC network, but I've moved it over to another server (Still Samba PDC) and now its breaking. Is there anyway for it to ignore the username/password prompt and just continue?

    Read the article

  • Nested IF's in Excel

    - by user1590499
    I have two columns with the following possibilities (0 for first column, and then 0 or 1 for second column; or a string for first column, and a 0 or 1 for second column). name,flag 0,0 david,0 0,1 sammy,1 How would I create a third column that looks like the following: name+flag 0 david 1 sammy Basically, if there are 2 0's in the two columns in a row, put a 0 in the new column. if there is a string in the first column in the row, no matter what the second column in the row says, put the string in the new column. and if there is a 0 in the first column and a 1 on the second column, put a 1 in the third column. Can I do this best with nested-if's? I tried something like name, flag, name+flag 0,0,=IF(A2<>0,A2,IF(B2=1,B2,0),0) But it didn't seem to work for me...

    Read the article

  • In Excel, given a worksheet "A", how do you create a sheet "B" that has a subset of the rows in "A"?

    - by user32706
    In Excel 2007, I have a sheet full of data "A". One of the columns in sheet "B" is called "Valid" and has either "yes" or "no". I've created a second sheet "B". It's easy to make each row in "A" appear in "B" if the row is valid using an 'if' statement in each cell. But if it's invalid, there's a blank row. I need "B" to show only the rows from "A" that are valid. TWO BIG CAVEATS: - No macros - No filtering (for long and complicated reasons). I feel like it might be possible with vlookup used cleverly, but so far, I'm stumped.

    Read the article

  • Problem deleting folder and files from "Program Files" folder in Win 7

    - by Craig Johnston
    How do you delete folders and files from the "Program Files" folder in Win 7? I am trying to do this on someone else's computer and I don't know what rights their user account is. It says that I don't have permission to delete the folder. I thought it was an administrator account because when I do "Run as Administrator" for other things it doesn't ask for a password, so it must be an administrator account. Should I be able to delete a folder out of "Program Files" if the account has administrator rights? Or do I need to do something else, such as "Take Ownership" of the folder.

    Read the article

  • My Macbook Pro wifi intermittently won't turn on sometimes after sleep, does anyone know how to solve this?

    - by Simon
    Hello, My current-generation MacBook Pro 15" (10.6.5) intermittently has problems turning the wifi (airport) on. The usual symptom happens when I: Sleep the machine Open from sleep Wifi is off (the airport signal is blank) I click on airport icon-Turn Airport On, but nothing happens. I googled around a bit and found one recommended solution where I delete the "automatic" location and create a new one and enable the wifi, or I delete the "AirPort" from the location and add it back, but neither of these resolve the problem. I also called AppleCare and they had me delete /Library/SystemConfiguration and restart, but that hasn't solved the problem. I have to reboot, which is very painful. Does anyone have any idea of how to solve this?

    Read the article

  • Del/Erase Commands

    - by Robert A Palmer
    I'm currently trying to use the del or the erase command in a RSM Telnet to delete Temp files on users computers. But the problem I'm running into with the command is that it is working, but won't delete any of the files located in the temp folder. Command I'm using : erase c:\users\[username]\appdata\local\temp I have used the command with the /p to prompt me, but some of these temp folders have thousands of files in them and sitting there and pressing Y and then enter endlessly is not going to work, because I have around 90 computers to clean temp files on. Is there something wrong with the command or is there a simpler command to use to delete the temp files on the computer? Thanks

    Read the article

  • Handling FreeBSD package upgrades using pkg_add

    - by larsks
    I'm trying to use FreeBSD's pkg_add command to install and upgrade binary packages in a build-once-install-on-multiple-machines sort of scenario. It works well when installing a new package, but upgrades are baffling me. For example, if I want to upgrade a package that is depended on by another package, I can't just install it: # pkg_add /path/to/somepackage-2.0.tbz pkg_add: package 'somepackage' or its older version already installed At this point, I can delete the older version of the package if I pass -f to the pkg_delete command: # pkg_delete -f somepackage-1.0 pkg_delete: package 'somepackage-1.0' is required by these other packages and may not be deinstalled (but I'll delete it anyway): anotherpackage-1.0 But...and this is the killer...now the dependency information is gone! I can install the upgrade: # pkg_add /path/to/somepackage-2.0.tbz And now attempts to delete it will succeed without any errors: # pkg_delete somepackage-2.0 How do I handle this gracefully (whereby "gracefully" means "in a fashion that preserves dependency information without requiring me to rebuild/reinstall and entire dependency chain"). Thanks!

    Read the article

  • Our GoDaddy web server is drowning in temp files!!

    - by temp file guy
    We have a virtual dedicated server with a fairly large amount of traffic. We use GoDaddy using CPanel. We have 10GIG of space of which about 80% is not our content but logs and server utilities. Godaddy support is evasive and they are trying to encourage us to migrate to new service with 15GIG. Reviewing the large files we found the following: We have a ton old TMP files at this directory. /public_html/files/TMP/FILE_PERSISTANCE_PROVIDER: (no access) some large files in these directories. /usr/local/apache/logs/ - suphp_log (220M) - access_log (7M) - error_log (5M) /usr/local/apache/domlogs/ (no access) /usr/local/cpanel/ (no access) /usr/local/cpanel-rollback /tmp Questions: What can we safely delete or truncate? How can we change permissions on files with no access to delete? Is there utility to monitor and clean up temp files Other files/programs that we can delete? thanks!

    Read the article

  • Can't remove Internet Explorer Add-On

    - by Emile
    I'm using IE8 on Windows 7. I'm trying to delete an add-on from my "Manage Add-ons" panel. But when I double click the add-on I'd like to delete, the "Remove" button is grayed out. Only the disable option is available. I've gone to the path it points to and deleted that folder. I've also searched the registry to delete keys and went to Control Panel to uninstall the related installation package. Any ideas?

    Read the article

  • how to stop a driver from running - it self protected and rootkit hidden

    - by Aristos
    I have this serous problem For the first time I can not stop a program from running. Something is on one laptop computer that is run as system legacy driver, and self protected and hidden on service as rootkit. Anything I try to remove fails. When a program or anti toolkit try to remove the hidden registry setting for make it stop I get this error : "a device attached to the system is not functioning" So any idea that can help me stop it from running, or even delete it on start up ? My one limitation is that the hard drive is on a laptop and I can not remove it and attact it to somewhere else. This program not let me, touch the registry, do not let me touch the file, do not let me touch the file, The move on boot fail to delete it, the rootrepeal fail to delete it, the rootkiet reveal from sysinternals fail to reveal it ! everything fails. Do how have any experience on this, or do you have any suggestion how to stop this driver from run ?

    Read the article

  • Can't insert cells in Excel 2010 - "operation not allowed" error message

    - by Force Flow
    I was working on a spreadsheet in Excel 2010, and all of a sudden when I attempted to insert a new row of cells, I saw that the insert and delete options were grayed out. I attempted to copy a different row and insert it as a new row, but I got the error message: "This operation is not allowed. The operation is attempting to shift cells in a table on your worksheet." I have not merged or hidden any cells/rows/columns. There are no formulas. There is no data verification. I tried closing and re-opening the spreadsheet. Searching for answers brings up nothing useful.

    Read the article

  • How to link data in different worksheets

    - by user2961726
    I tried consolidation but I can not get the following to work as it keeps saying no data consolidated. Can somebody try this dummy application and if they figure out how to do the following below can give me a step by step guide so I can attempt myself to learn. I'm not sure if I need to use any coding for this: In the dummy application I have 2 worksheets. One known as "1st", the other "Cases". In the "1st" worksheet you can insert and delete records for the "Case" table at the bottom, what I want to do is insert a row into the Case Table in worksheet "1st" and enter in the data for that row. What should happen is that data should be automatically be updated in the table in the "Cases" worksheet. But I can't seem to get this to work. Also if I delete a row from the table in Worksheet "1st" it should automatically remove that record from the "Cases" worksheet table. Please help. Below is the spreadsheet: http://ge.tt/8sjdkVx/v/0

    Read the article

  • rsync to ONLY keep files in destination that have been removed from source

    - by David Corley
    We use rsync to copy filesystem contents from one machine to another as a backup. We first run MACHINE-X-MACHINE-Y rsync for a straight backup with the --delete and --delete-excluded switches We also run an internal Rsync between the MACHINE-Y destination, and another folder on MACHINE-Y with either of the delete flags. This maintains a non-destructive copy in the event someone inadvertently deletes a file on MACHINE-X. However, it also has the overhead of being a complete copy of what has already been synchronized. Ideally I want to be able to run the non-destructive rsync in such a way that the destination ONLY receives the deleted files and so avoids unnecessary duplication . Is there any way to do this?

    Read the article

  • Prevent folder deletes at top level only on Server 2008

    - by DomoDomo
    I'm trying to prevent folders moves, really folder delete in NTFS parlance, for series of folders within a network share. So let's say I have: FolderA, FolderB, FolderC. Each folder has various files and subfolders. I want the Domain Users group to have modify access to all files and folders beneath FolderA, FolderB, and FolderC. However I don't want them to be able to delete these three top level folders. The issue we are having right now is people keep accidentally dragging one top level folder into another. I've tried used advanced NTFS permissions to deny domain users delete access to these top level folders, and set the permissions to apply to "This folder only", however it seems to only affect sub-folders, and not the top level. Platform is Server 2008 Standard. Thanks in advance.

    Read the article

  • 3 Root accounts in MySQl database

    - by hairbymaurice
    Hello, I have managed to get mySQL running under Ubuntu 8.10, I am now diligently trying to secure the database and am adding passwords for the root users. My question: I have a root user under the host "kickseed" with no password set I have no idea what kickseed is as the database is installed under localhost, on searching around i have discovered that this is something to do with the ubuntu OS itself. Is it safe to delete this user account from MySQL or is it used for something by the OS? If i need to keep it should i /can i protect it with a password? Also i have another root account under the host IP 127.0.0.1 again can i delete this? My absolute preference would be to have only one account with root access but i do not want to delete these accounts if they are necessary. Thanks for tolerating a newbie Regards Hairby

    Read the article

  • Repeat the csv header twice without "Append" (PowerShell 1.0)

    - by Mark
    I have prepared a PowerShell script to export a list of system users in CSV format. The script can output the users list with Export-csv with single header row (the header row at top). However my requirement is to repeat the header row twice in my file. It is easy to achieve in PowerShell 3.0 with "Append" (e.g. $header | out-file $filepath -Append) Our server envirnoment is running PowerShell 1.0. Hence I cannot do it. Is there any workaround? I cannot manually add it myself. Thank you.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 173 174 175 176 177 178 179 180 181 182 183 184  | Next Page >