Search Results

Search found 990 results on 40 pages for 'readline'.

Page 18/40 | < Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >

  • Factory Method Pattern using Generics-C#

    - by nanda
    Just I am learning Generics.When i have an Abstract Method pattern like : //Abstract Product interface IPage { string pageType(); } //Concerete Product 1 class ResumePage : IPage { public string pageType() { return "Resume Page"; } } //Concrete Product 2 class SummaryPage : IPage { public string pageType() { return "SummaryPage"; } } //Fcatory Creator class FactoryCreator { public IPage CreateOnRequirement(int i) { if (i == 1) return new ResumePage(); else { return new SummaryPage(); } } } //Client/Consumer void Main() { FactoryCreator c = new FactoryCreator(); IPage p; p = c.CreateOnRequirement(1); Console.WriteLine("Page Type is {0}", p.pageType()); p = c.CreateOnRequirement(2); Console.WriteLine("Page Type is {0}", p.pageType()); Console.ReadLine(); } how to convert the code using generics?

    Read the article

  • Android: How to read a txt file which contains Chinese characters?

    - by TianDong
    Hallo, i have a txt file which contains many chinese characters, and the txt file is in the directory res/raw/test.txt. I want to read the file but somehow i can't make the chinese characters displayed correctly. Here is my code: try { InputStream inputstream = getResources().openRawResource(R.raw.test); BufferedReader bReader = new BufferedReader(new InputStreamReader(inputstream,Charset.forName("UTF-8"))); String line = null; while ((line= bReader.readLine())!= null) { Log.i("lolo", line); System.out.println("here is some chinese character ???????"); } } catch (IOException e) { e.printStackTrace(); } Both Log.i("lolo", line); and System.out.println("here is some chinese character ???????") don't show characters correctly, i can not even see the chinese characters in the println() method. What can i do to fix this problem? Can anybody help me?

    Read the article

  • How to create a Java String from the contents of a file

    - by Oscar Reyes
    I've been using this idiom for some time now. And it seems to be the most wide spread at least in the sites I've visited. Does anyone have a better/different way to read a file into a string in Java. Thanks private String readFile( String file ) throws IOException { BufferedReader reader = new BufferedReader( new FileReader (file)); String line = null; StringBuilder stringBuilder = new StringBuilder(); String ls = System.getProperty("line.separator"); while( ( line = reader.readLine() ) != null ) { stringBuilder.append( line ); stringBuilder.append( ls ); } return stringBuilder.toString(); }

    Read the article

  • why egrep's stdout did not go through pipe?

    - by ccfenix
    Hi, i got a weird problem regarding egrep and pipe I tried to filter a stream containing some lines who start with a topic name, such as "TICK:this is a tick message\n" When I try to use egrep to filter it : ./stream_generator | egrep 'TICK' | ./topic_processor It seems that the topic_processor never receives any messages However, when i use the following python script: ./stream_generator | python filter.py --topics TICK | ./topic_processor everything looks to be fine. I guess there need to be a 'flush' mechanism for egrep as well, is this correct? Can anyone here give me a clue? Thanks a million import sys from optparse import OptionParser if __name__ == '__main__': parser = OptionParser() parser.add_option("-m", "--topics", action="store", type="string", dest="topics") (opts, args) = parser.parse_args() topics = opts.topics.split(':') while True: s = sys.stdin.readline() for each in topics: if s[0:4] == each: sys.stdout.write(s) sys.stdout.flush()

    Read the article

  • How to get java to recognize symbolic links under cygwin

    - by Keith Randall
    Here's a very simple java program to print the first line of a file: import java.io.* public class test { public static void main(String[] args) throws IOException { System.out.print(new BufferedReader(new FileReader(args[0])).readLine()); } } When I run this program under cygwin and pass it the name of a symbolic link, it prints the contents of the symbolic link, not the target of that link: $ echo foo > testfile $ ln -s testfile symlink_to_testfile $ java test testfile foo $ java test symlink_to_testfile !<symlink> ?t e s t f i l e How do I convince java to follow the symlink? I was hoping there was something simpler than implementing the redirect myself.

    Read the article

  • Why isn't the static constructor of the parent class called when invoking a method on a nested class

    - by Ryan Ische
    Given the following code, why isn't the static constructor of "Outer" called after the first line of "Main"? namespace StaticTester { class Program { static void Main( string[] args ) { Outer.Inner.Go(); Console.WriteLine(); Outer.Go(); Console.ReadLine(); } } public static partial class Outer { static Outer() { Console.Write( "In Outer's static constructor\n" ); } public static void Go() { Console.Write( "Outer Go\n" ); } public static class Inner { static Inner() { Console.Write( "In Inner's static constructor\n" ); } public static void Go() { Console.Write( "Inner Go\n" ); } } } }

    Read the article

  • EndpointNotFoundException when working through tutorials in Learning WCF

    - by Nicholas
    I am working through the book Learning WCF and on the first tutorial lab HelloIndigo I am receiving the following error. Could not connect to http://localhost:8000/HelloIndigo/HelloIndigoService. TCP error code 10061: No connection could be made because the target machine actively refused it 127.0.0.1:8000. It appears in the Client project on the line string s = proxy.HelloIndigo(); EndpointAddress ep = new EndpointAddress("http://localhost:8000/HelloIndigo/HelloIndigoService"); IHelloIndigoService proxy = ChannelFactory<IHelloIndigoService>. CreateChannel(new BasicHttpBinding(), ep); string s = proxy.HelloIndigo(); Console.WriteLine(s); Console.WriteLine("Press <ENTER> to terminate Client"); Console.ReadLine(); I have intensively googled on this but I am none the wiser. Can anyone explain the issue and how to remedy?

    Read the article

  • How can i take only integer input from keyboard and if input is invalid how do i ask user agaian

    - by fari
    This is what i have written so far but when exception is raised it does not again ask teh user for input. do{ System.out.println("Enter the number of stones to play with: "); BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); String temp=br.readLine(); }while (key<0 && key>9); if(key<0 || key>10) throw new InvalidStartingStonesException(key); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); this.player1=player1; this.player2=player2; state=new KalaGameState(key); } catch(NumberFormatException nFE) { System.out.println("Not an Integer");} catch(IOException e) { System.out.println(e); }

    Read the article

  • Unable to catch exception from Activator.CreateInstance.

    - by Patrik Hägne
    OK, I admit it this code will just look weird to you, and that's because it is weird. This is just code to reproduce the behavior, not code I want to use. class Program { static void Main(string[] args) { try { Activator.CreateInstance(typeof(Func<int>), new object[] { new object(), IntPtr.Zero }); } catch { Console.WriteLine("This won't print!"); } Console.Write("Actually this will not print either!"); Console.ReadLine(); } } No matter what exception type I try to catch (the actual exception thrown is an ArgumentException as far as I can tell) the code inside the catch block will not execute. Actually execution will just stop at the Activator.CreateInstance-line.

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Return/consume dynamic anonymous type across assembly boundaries

    - by friism
    The code below works great. If the Get and Use methods are in different assemblies, the code fails with a RuntimeBinderException. This is because the .Net runtime system only guarantees commonality of anonymous types (<string, int> in this case) within assemblies. Is there any way to fool the runtime system to overcome this? I can expect the object in the debugger on the Use side, and the debugger can see the relevant properties. class Program { static void Main(string[] args) { UsePerson(); Console.ReadLine(); } public static void UsePerson() { var person = GetPerson(); Console.WriteLine(person.Name); } public static dynamic GetPerson() { return new { Name = "Foo", Age = 30 }; } }

    Read the article

  • C# streamreader, delimiter problem.

    - by Mike
    What I have is a txt file that is huge, 60MB. I need to read each line and produce a file, split based on a delimiter. I'm having no issue reading the file or producing the file, my complication comes from the delimiter, it can't see the delimiter. If anybody could offer a suggestion on how to read that delimiter I would be so grateful. delimiter = Ç public void file1() { string betaFilePath = @"C:\dtable.txt"; StringBuilder sb = new StringBuilder(); using (FileStream fs = new FileStream(betaFilePath, FileMode.Open)) using (StreamReader rdr = new StreamReader(fs)) { while (!rdr.EndOfStream) { string[] betaFileLine = rdr.ReadLine().Split('Ç'); { sb.AppendLine(betaFileLine[0] + "ç" + betaFileLine[1] + betaFileLine[2] + "ç" + betaFileLine[3] + "ç" + betaFileLine[4] + "ç" + betaFileLine[5] + "ç" + betaFileLine[6] + "ç" + betaFileLine[7] + "ç" + betaFileLine[8] + "ç" + betaFileLine[9] + "ç" + betaFileLine[10] + "ç"); } } } using (FileStream fs = new FileStream(@"C:\testarea\load1.txt", FileMode.Create)) using (StreamWriter writer = new StreamWriter(fs)) { writer.Write(sb.ToString()); } }

    Read the article

  • Attribute class not calling constructor

    - by Coppermill
    I have created an Attribute, call MyAttribute, which is performing some security and for some reason the Constructor is not being fired, any reason why? public class Driver { // Entry point of the program public static void Main(string[] Args) { Console.WriteLine(SayHello1("Hello to Me 1")); Console.WriteLine(SayHello2("Hello to Me 2")); Console.ReadLine(); } [MyAttribute("hello")] public static string SayHello1(string str) { return str; } [MyAttribute("Wrong Key, should fail")] public static string SayHello2(string str) { return str; } } [AttributeUsage(AttributeTargets.Method)] public class MyAttribute : Attribute { public MyAttribute(string VRegKey) { if (VRegKey == "hello") { Console.WriteLine("Aha! You're Registered"); } else { throw new Exception("Oho! You're not Registered"); }; } }

    Read the article

  • How can I pause the console window in .pl and .bat file?

    - by Nano HE
    As I know, when I run cs myConsoleApp.cs from windows command line, I can pause the Console Window by add the code below: Console.ReadLine(); Then How can I pause Console Window in myConsoleApp.pl and myConsoleApp.bat? I just want to monitor the running result from the Console window. Thank you. Suppose myConsoleApp.bat like this: taskkill /f /im "E1.exe" taskkill /f /im "E2.exe" pause Suppose myConsoleApp.pl like this: use strict; use warnings; print "Hello World!"; <>;

    Read the article

  • Java RandomAccessFile - dealing with different newline styles?

    - by waitinforatrain
    Hey, I'm trying to seek through a RandomAccessFile, and as part of an algorithm I have to read a line, and then seek backwards from the end of the line E.g String line = raf.readLine(); raf.seek (raf.getFilePointer() - line.length() + m.start() + m.group().length()); //m is a Matcher for regular expressions I've been getting loads of off-by-one errors and couldn't figure out why. I just discovered it's because some files I'm reading from have UNIX-style linefeeds, \r\n, and some have just windows-style \n. Is there an easy to have the RandomAccessFile treat all linefeeds as windows-style linefeeds?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • openssl error wehn compiling Ruby from source

    - by Florian Salihovic
    Prelude: I don't want to use rvm. I installed ruby 2 with the following configuration on Mac OS X 10.8.5 ./configure --prefix=/usr/local \ --enable-pthread \ --with-readline-dir=/usr/local \ --enable-shared It is installed, version is printed correctly ... Now, when invoking gem install jekyll I get the following error: ERROR: Loading command: install (LoadError) cannot load such file -- openssl ERROR: While executing gem ... (NoMethodError) undefined method `invoke_with_build_args' for nil:NilClass I installed openssl into /usr/local but i'm really banging my head against the wall on how installing gems. It can't be that big of a deal right?

    Read the article

  • how to read the txt file from the database(line by line)

    - by Ranjana
    i have stored the txt file to sql server database . i need to read the txt file line by line to get the content in it. my code : DataTable dtDeleteFolderFile = new DataTable(); dtDeleteFolderFile = objutility.GetData("GetTxtFileonFileName", new object[] { ddlSelectFile.SelectedItem.Text }).Tables[0]; foreach (DataRow dr in dtDeleteFolderFile.Rows) { name = dr["FileName"].ToString(); records = Convert.ToInt32(dr["NoOfRecords"].ToString()); bytes = (Byte[])dr["Data"]; } FileStream readfile = new FileStream(Server.MapPath("txtfiles/" + name), FileMode.Open); StreamReader streamreader = new StreamReader(readfile); string line = ""; line = streamreader.ReadLine(); but here i have used the FileStream to read from the Particular path. but i have saved the txt file in byt format into my Database. how to read the txt file using the byte[] value to get the txt file content, instead of using the Path value.

    Read the article

  • Ruby Thread with "watchdog"

    - by Sergio Campamá
    I'm implementing a ruby server for handling sockets being created from GPRS modules. The thing is that when the module powers down, there's no indication that the socket closed. I'm doing threads to handle multiple sockets with the same server. What I'm asking is this: Is there a way to use a timer inside a thread, reset it after every socket input, and that if it hits the timeout, closes the thread? Where can I find more information about this? EDIT: Code example that doesn't detect the socket closing require 'socket' server = TCPServer.open(41000) loop do Thread.start(server.accept) do |client| puts "Client connected" begin loop do line = client.readline open('log.txt', 'a') { |f| f.puts line.strip } end rescue puts "Client disconnected" end end end

    Read the article

  • GoTo statements, and alternatives (help me please im new) (VB.net)

    - by qais
    Basically I posted a code snippet on a forum asking for help and people pointed out to me that using GoTo statements is very bad programming practise so I'm just wondering, why is it bad? And also what alternative is there to use, like for example in this program ive done for homework the user has to input their date of birth and if the month/date/year are invalid or unrealistic(using if statements checking the integer inputs size, if theres any better way to do this i'd appreciate if you could tell me that also :D) then how would i be able to loop back to ask them again? heres a little extract of my code retryday: Console.WriteLine("Please enter the day you were born : ") day = Console.ReadLine If day > 31 Or day < 1 Then Console.WriteLine("Please enter a valid day") GoTo retryday End If

    Read the article

  • Any way to use a class extension method to support an interface method in C#?

    - by dudeNumber4
    Console app below compiles, but the interface cast fails at run time. Is there an easy way to make this work? namespace ConsoleApplication1 { class Monkey { public string Shock { get { return "Monkey has been shocked."; } } } static class MonkeyExtensionToSupportIWombat { public static string ShockTheMonkey( this Monkey m ) { return m.Shock; } } interface IWombat { string ShockTheMonkey(); } class Program { static void Main( string[] args ) { var monkey = new Monkey(); Console.WriteLine( "Shock the monkey without the interface: {0}", monkey.Shock ); IWombat wombat = monkey as IWombat; Console.WriteLine( "Shock the monkey with the interface: {0}", wombat.ShockTheMonkey() ); Console.ReadLine(); } } }

    Read the article

  • Problem with "scopes" of variables in try catch blocks in Java

    - by devoured elysium
    Could anyone explain me why in the last lines, br is not recognized as variable? I've even tried putting br in the try clause, setting it as final, etc. Does this have anything to do with Java not support closures? I am 99% confident similar code would work in C#. private void loadCommands(String fileName) { try { final BufferedReader br = new BufferedReader(new FileReader(fileName)); while (br.ready()) { actionList.add(CommandFactory.GetCommandFromText(this, br.readLine())); } } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } finally { if (br != null) br.close(); //<-- This gives error. It doesn't // know the br variable. } } Thanks

    Read the article

  • How to write a shell in Python

    - by panzi
    I've written a small console application that can perform certain tasks. The user interface is similar to things like version control systems or yum etc. So basically you can think of it as a domain specific language. Now I'd like to write a (bash like) shell that can execute and auto-complete this language and has a command history (so I do not have to load and save the quite large xml files on each command). In a nutshell I want something like ipython but not for executing python code but my own DSL. Are there any libraries that help me doing this? I see that there is a readline and rlcompleter module in python but its documentation seems to indicate that this is only for use with the python shell itself, or did I miss something there?

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • How can I have MySQL write outfiles as a different user?

    - by David Locke
    I'm working with a MySQL query that writes into an outfile. I run this query once every day or two and so I want to be able to remove the outfile without having to resort to su or sudo. The only way I can think of making that happen is to have the outfile written as owned by someone other than the mysql user. Is this possible? Edit: I am not redirecting output to a file, I am using the INTO OUTFILE part of a select query to output to a file. If it helps: mysql --version mysql Ver 14.12 Distrib 5.0.32, for pc-linux-gnu (x86_64) using readline 5.2

    Read the article

< Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >