Search Results

Search found 17719 results on 709 pages for 'tim long'.

Page 18/709 | < Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >

  • Windows takes a very long time to shut down even in safe mode

    - by user1526247
    On Windows 7 the computer freezes for about 5 minutes once it gets to "Shutting down...". I can't remember when it started happening. I just lived with it for a while. The first thing I tried was a full scan using Microsoft Security Essentials. This did not solve the problem. I then went into msconfig and turned off everything I could get away with in the startup and services tabs. This did not solve the problem. I then uninstalled every program on this computer save the most basic programs. This did not solve the problem (did not uninstall drivers or catalyst). I then went through and turned off every single service and did a reboot. This did not solve the problem. I then booted into safe mode and just tried shutting it down. The problem even happens in safe mode. I have tried examining the event logs but with no success. They just say things like "blah blah has entered the stopped state" with no real clues about what program is causing me all this grief. *it may be worth noting that Ubuntu is installed on the same computer and the ubuntu boot loader is the one being used.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • It takes a long time until windows xp recognize I connected USB diks

    - by Pavol G
    Hello IT guys, I have a problem with my new USB disk. When I connect it to my laptop with Windows XP SP2 it takes about 4-5min until Windows recognized it and show it as a new disk. I can also see (disk's LED is blinking) that something is scaning the disk when I connect it, when this is done Windows imediately recognize it. Also when I'm copying data to this disk the speed is about 3.5MB/sec. It's connected using USB2.0. I tried to check for spyware (using spybot), also run windows in safe mode. But still have the same problems. Do you have any idea what could help to solve this problem? On Windows Vista (another laptop) everything is ok, disk loads in about 15sec and speed is about 20-30MB/sec. Thanks a lot for every advice!

    Read the article

  • How long would this file transfer take?

    - by CT
    I have 12 hours to backup 2 TB of data. I would like to backup to a network share to a computer using consumer WD 2TB Black 7200rpm hard drives. Gigabit Ethernet. What other variables would I need to consider to see if this is feasible? How would I set up this calculation?

    Read the article

  • "ssh root@server" hangs indefinitely long

    - by Thibaut
    Hi, Sometimes my ssh client will take forever to login. This happens when the server is not responding (overloaded, killed processed, ...). My automated scripts will then fail because the ssh process will never exit. Is there a ssh configuration value to set a timeout in order to fail if ssh can't login after a predefined number of seconds? I know there are knobs on the server side, but I have to set this on the client side as the sshd process is not responding, or responding incorrectly. Thanks!

    Read the article

  • Long term system health monitor

    - by user30336
    As an experienced user, I sometimes notice that things are not going well with my computer. For example, my backup drive recently started cycling up and down, so I guessed it was probably dying, and replaced it. I detected this with my ears. Windows did not seem to notice or care. There ought to be software that monitors overall system health by keeping track of things like this, so that unusual events or increasing error rates will not be shrugged off. Among other things: disk errors that are recovered, corrupt network packets (at above the baseline expected rate) and crashes of trusted programs are early warnings. Is there any software that tries to use this kind of monitoring to warn of impending trouble?

    Read the article

  • Packing a long binary integer in Ruby

    - by user1056142
    I'm trying to send a very long binary integer over UDP (on the order of 200 bits). When I try to use Array's pack method, it complains the string I'm trying to convert is too large. Am I going about this the wrong way? ruby-1.8.7-p352 :003 > [0b1101001010101101111010100101010011010101010110010101010101010010010101001010101010101011101010101010101111010101010101010101].pack('i') RangeError: bignum too big to convert into `unsigned long' from (irb):3:in `pack' from (irb):3 This number is supposed to represent a DNS query packet (this is for a homework assignment; we're not allowed to use any DNS libraries).

    Read the article

  • retreving long text (CLOB) using CFQuery

    - by CFUser
    I am using CFQuery to retrieve the CLOB field from Oracle DB. If the CLOB filed contains the Data less than ~ 8000, then I can see retrieved the value ( the o/p), however If the value in CLOB field size is more than 8000 chars, then its not retrieving the value. in <cfdump> i can see the query retrieved as 'empty String' though the value exists in Oracle DB. I am using the Oracle Driver in CFadim console enabled 'Enable long text retrieval (CLOB).' and 'Enable binary large object retrieval (BLOB). ' set 'Long Text Buffer (chr)' and 'Blob Buffer(bytes) ' values to 6400000 any suggestions to retrieve the full text?

    Read the article

  • ASP.NET Lifecycle and long process

    - by user204588
    Hello, I know we need a better solution but we need to get this done this way for right now. We have a long import process that's fired when you click start import button on a aspx web page. It takes a long time..sometimes several hours. I changed the timeout and that's fine but I keep getting a connection server reset error after about an hour. I'm thinking it's the asp.net lifecycle and I'd like to know if there are settings in IIS I can change to make this lifecycle last longer.

    Read the article

  • WPF: isolated storage file path too long

    - by user342961
    Hi, I'm deploying my WPF app with ClickOnce. When developing locally in Visual Studio, I store files in the isolated storage by calling IsolatedStorageFile.GetUserStoreForDomain(). This works just fine and the generated path is C:\Users\Frederik\AppData\Local\IsolatedStorage\phqduaro.crw\hux3pljr.cnx\StrongName.kkulk3wafjkvclxpwvxmpvslqqwckuh0\Publisher.ui0lr4tpq53mz2v2c0uqx21xze0w22gq\Files\FilerefData\-581750116 (189 chars) But when I deploy my app with ClickOnce, the generated path becomes too long, resulting in a DirectoryNotFoundException when creating the isolated storage directory. The generated path with ClickOnce is: C:\Users\Frederik\AppData\Local\Apps\2.0\Data\OQ0LNXJT.R5V\8539ABHC.ODN\exqu..tion_e07264ceafd7486e_0001.0000_b8f01b38216164a0\Data\StrongName.wy0cojdd3mpvq45404l3gxdklugoanvi\Publisher.ui0lr4tpq53mz2v2c0uqx21xze0w22gq\Files\FilerefData\-581750116 (247 chars) When I browse the folders all but the last directory of the path exists. Then when trying to create a folder at this location windows tells me I can't create a directory because the resulting path name will be too long. How can I shorten the path generated by the IsolatedStorage?

    Read the article

  • Prefilling large volumes of body text in GMAIL compose getting a Request URI too long error

    - by Ali
    Hi guys this is a followup from the question: http://stackoverflow.com/questions/2583928/prefilling-gmail-compose-screen-with-html-text Where I was building a google apps application - I can call a gmail compose message page from my application using the url: https://mail.google.com/a/domain/?view=cm&fs=1&tf=1&source=mailto&to=WHOEVER%40COMPANY.COM&su=SUBJECTHERE&cc=WHOEVER%40COMPANY.COM&bcc=WHOEVER%40COMPANY.COM&body=PREPOPULATEDBODY However when I try to pass in the body parameter a very long line of text eg as a reply message body I get this error from GMAIL stating the REQUEST URI is too long. Is there a better way to do this as in a way to fillin the text body box of gmail compose section. Or some way to open the page and have it prefilled with javascript some how...

    Read the article

  • PHP: why uniqid returned value is only 13 digits long

    - by Marco Demaio
    uniqid() function returns a 13 digits long hexadecimal number. According to the spec in php.net site, the function uses microtime to generate the unique value. But microtime returns numbers in string format as the following one: "0.70352700 12689396875" which are basically the microseconds and the seconds elapsed since 1970. This is a 9+11 digits decimal number. Converting a 20 decimal number into hex would result in a 16 digits hexadecimal NOT a 13 digits one. I also thought to take out the "0." part that seem to never change, and the last two digits of the microsec part that seem to remain always "00". Doing this the decimal number would be only 9+11-3 digits long, but still a decimal number of 17 digits when converted into hex would result in 14 digits hexadecimal number NOT 13. You probably think I'm crazy in asking such a thing, but I'm concerned about using uniqid, unique values are important to be unique, a duplicated value could screw up an entire application.

    Read the article

  • Need an ASP.NET MVC long running process with user feedback

    - by Jason
    I've been trying to create a controller in my project for delivering what could turn out to be quite complex reports. As a result they can take a relatively long time and a progress bar would certainly help users to know that things are progressing. The report will be kicked off via an AJAX request, with the idea being that periodic JSON requests will get the status and update the progress bar. I've been experimenting with the AsyncController as that seems to be a nice way of running long processes without tying up resources, but it doesn't appear to give me any way of checking on the progress (and seems to block further JSON requests and I haven't discovered why yet). After that I've tried resorting to storing progress in a static variable on the controller and reading the status from that - but to be honest that all seems a bit hacky! All suggestions gratefully accepted!

    Read the article

  • Get a substring of a long string which fits in a width

    - by Lu Lu
    Hello everyone, I have a long string, ex: "Please help me to solve this problem." This string is so long to fit in a width of 100 pixels. I need to get a substring of this string and substring will fit in 100 pixels. Ex: substring "Please help me to sol" is fit in 100 pixels. Please help me how to estimate a substring like this. Thanks. My application is Win Forms and C#.

    Read the article

  • Setting column length of a Long value with JPA annotations

    - by Gearóid
    Hi, I'm performing a little database optimisation at the moment and would like to set the column lengths in my table through JPA. So far I have no problem setting the String (varchar) lengths using JPA as follows: @Column(unique=true, nullable=false, length=99) public String getEmail() { return email; } However, when I want to do the same for a column which is of type Long (bigint), it doesn't work. For example, if I write: @Id @Column(length=7) @GeneratedValue(strategy = GenerationType.AUTO) public Long getId() { return id; } The column size is still set as the default of 20. Are we able to set these lengths in JPA or am I barking up the wrong tree? Thanks, Gearoid.

    Read the article

  • Classes missing if application runs for a long time

    - by Rogach
    I have a funny problem - if my application runs for a long time ( 20h), then sometimes I get NoClassDefFound error - seems like JVM decided that the class is not going to be used anyway and GCd it. To be a bit more specific, here's an example case: object ErrorHandler extends PartialFunction[Throwable,Unit] { def isDefinedAt(t: Throwable) = true def apply(e: Throwable) =e match { // ... handle errors } } // somewhere else in the code... try { // ... long running code, can take more than 20 hours to complete } catch (ErrorHandler) And I get the following exception: Exception in thread "main" java.lang.NoClassDefFoundError: org/rogach/avalanche/ErrorHandler$ If that try/catch block runs for smaller amounts of time, everything works as expected. If anyone is interested, here is the codebase in question: Avalanche I need to note that I saw this and similar problems only on Cent OS 5 machines, using JRE 6u26 and Scala 2.9.1 / 2.9.2. What could be the cause of this problem?

    Read the article

  • How does a WCF server inform a WCF client about changes? (Better solution then simple polling, e.g.

    - by Ian Ringrose
    see also "WCF push to client through firewall" I need to have a WCF client that connect to a WCF server, then when some of the data changes on the server the clients need to update its display. As there is likely to be a firewall between the clients and the server. All communications must be over HTTP The server can not make an (physical) outgoing call to the client. As I am writing both the client and the server I do not need to limit the solution to only using soap etc. I am looking for built in surport for "long polling" / "Comet" etc Thanks for the most informative answer from Drew Marsh on how to implement long polling in WCF. However I thought the main “selling point” of WCF was that you could do this sort of thing just by configuring the channels to be used in the config file. E.g I want a channel that logically two way but physically incoming only.

    Read the article

  • Store a long string into mult array

    - by QLiu
    Hello All, I have a long string arrays, which looks like that var callinfo_data=new Array( "1300 135 604#<b>Monday - Friday: 9:00 a.m. to 5:30 p.m. AEST</b>", //Australia .. "0844000040#<b>lunedì-venerdì ore 10:00 - 17:00 CET</b>", //Switzerland (it) "212 356 9707#<b>Hafta içi her gün: 10:00 - 18:00</b>", //Turkey "08451610009#<b>Monday - Friday: 9:00 a.m. to 6:30 p.m. GMT</b>", //UK "866 486 6866#<b>Monday - Friday: 7:00 a.m. to 11:00 p.m. EST</b><br />Saturday: 9:00 a.m. to 8:00 p.m. EST", //USA "+31208501004#<b>Monday - Friday: 9:00 a.m. to 7:30 p.m. GMT+1</b>", //other countries " # "); As you see, it contact Phone number and open time. I can use split to separet them into info=callinfo_data[n].split("#"); two sections, And then i can represent them in HTML like "<div id ='phoneNumber'>"+info[0]+"</div><div id='openTime'>"+info[1]+"</div>" But my display phone number function will read the cookie variables, and then select the right contact info to display. Like, phone=callinfo_data[2].split("#"); if (locale == 'UK') details = phone[0]+ build_dropdown(locale); else if (locale == 'fr') details = 'French Contact Details<br>'+build_dropdown(locale); else if (locale == 'be') details = 'Belgian Contact Details<br>'+ build_dropdown(locale); else details = 'Unknown Contact Detail'; writeContactInfo(details); My questions are how I can build a function to load phone number and time based on my cookie variables, UK in a smart way. I can hard code everything, but i think it is too silly. I have to write a long code like: phone1= allinfo_data[0].split("#"); phone1= allinfo_data[1].split("#"); ... etc Second questions, how can I load this long arrays into easy access multi arrays? Thank you Regards, Qing

    Read the article

  • Handling over-long UTF-8 sequences

    - by Grant McLean
    I've just been reworking my Encoding::FixLatin Perl module to handle over-long utf8 byte sequences and convert them to the shortest normal form. My question is quite simply "is this a bad idea"? A number of sources (including this RFC) suggest that any over-long utf8 should be treated as an error and rejected. They caution against "naive implementations" and leave me with the impression that these things are inherently unsafe. Since the whole purpose of my module is to clean up messy data files with mixed encodings and convert them to nice clean utf8, this seems like just one more thing I can clean up so the application layer doesn't have to deal with it. My code does not concern itself with any semantic meaning the resulting characters might have, it simply converts them into a normalised form. Am I missing something. Is there a hidden danger I haven't considered?

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • How Long: Converting HTML to Jooma pages

    - by George
    Hello Everyone, I would really appreciate your help with finding out how long it takes a 1-3 year experenced programmer to convert a few HTML pages into joomla 1.5 dynamic pages. I know that some of it depends on how complex the pages are but i'm talking about average pages. That's my first question, my other question is how long will it take a 1-3 year experenced programmer to install all of these componants: Video module, photo gallery module, vertuemart shopping cart. I pay programmers to do this work but i have to make as sure as i can that i'm not over paying them. Thanks in advance for answering these two questions...George

    Read the article

  • printing long compilation lines with MS NMAKE

    - by Elazar Leibovich
    I have a legacy MS NMAKE Makefile I need to fix a few bugs in. There are some very long command lines I wish to debug that are being executed using the NMAKE trick of "inline files": dep: cmd @<<tmpfilename cmd_args.. << When changing the line to dep: echo cmd @<<tmpfilename cmd_args.. << NMAKE complains that the line is too long. Is there any other trick I can apply in order to view the command line NMAKE is actually executing?

    Read the article

< Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >