Search Results

Search found 23657 results on 947 pages for 'install sequence'.

Page 182/947 | < Previous Page | 178 179 180 181 182 183 184 185 186 187 188 189  | Next Page >

  • installing lots of perl modules

    - by Colin Pickard
    Hi, I've been landed with the job of documenting how to install a very complicated application onto a clean server. Part of the application requires a lot of perl scripts, each of which seem to require lots of different perl modules. I don't know much about perl, and I only know one way to install the required modules. This means my documentation now looks this: Type each of these commands and accept all the defaults: sudo perl -MCPAN -e 'install JSON' sudo perl -MCPAN -e 'install Date::Simple' sudo perl -MCPAN -e 'install Log::Log4perl' sudo perl -MCPAN -e 'install Email::Simple' (.... continues for 2 more pages... ) Is there any way I can do all this one line like I can with aptitude i.e. Type the following command and go get a coffee: sudo aptitude install openssh-server libapache2-mod-perl2 build-essential ... Thank you (on behalf of the long suffering people who will be reading my document) EDIT: The best way to do this is to use the packaged versions. For the modules which were not packaged for Ubuntu 10.10 I ended up with a little perl script which I found here ) #!/usr/bin/perl -w use CPANPLUS; use strict; CPANPLUS::Backend->new( conf => { prereqs => 1 } )->install( modules => [ qw( Date::Simple File::Slurp LWP::Simple MIME::Base64 MIME::Parser MIME::QuotedPrint ) ] ); This means I can put a nice one liner in my document: sudo perl installmodules.pl

    Read the article

  • Is it possible/practical to install and run Linux on a USB flash drive?

    - by Graeme Donaldson
    I'm going to replace my old 2004 vintage desktop PC soon and I have an idea of what I want to do, I'm just not sure if it's possible or realistic. In the time since I built the old PC it has slowly become less used as a PC and more as a file server, so I figured I'd build a small file server which could also function as a router/DHCP/DNS/whatever box. The idea is to base it on an Atom system. I have my eye on the Intel D510MO for the moment. This supports 2 SATA disks, and I'd prefer to dedicate those to data storage. I'd like to install Ubuntu Server or maybe Debian on a 8/16GB USB flash drive. I have seen plenty of tutorials on how to perform an installation from a USB drive, but I can't seem to find any info on actually booting and running the OS from USB flash. Is this even possible? Is it practical? This box will mostly be used for: Making backups of mine and my wife's notebooks via LAN. Will use SMB or NFS for this. Digital media storage, which will be accessed by a Mede8er box with no storage of its own. I will most likely use NFS for this.

    Read the article

  • Shuffling in windows media player

    - by Crazy Buddy
    I think media player has several issues indeed. You see, I'll be hearing songs most of the time using WMP 11 (in WinXP SP3). Today - While I was wasting my time poking some sleepy questions in SE, I also noticed this... My "Now-playing" list contains some 500 mp3s (doesn't matter). I've enabled both Shuffle and Repeat. I play those songs. When I get irritated with some song (say - the 10th song), I change it. Something mysterious happened (happens even now). A sequence of atleast 3 songs (already played before the 10th song) repeat again in the same way following the selected one... Then, I skip those somehow and arrive at another boring song (say now - 20th) and now, the sequence would've increased by about 5 songs (sometimes)... Sometimes, I even notice a specific "sequence of songs" (including the skipped one) repeating again & again. I doubt most guys would've noticed. This makes me ask a question - Why? There are a lot songs in my playlist. Why the same sets of songs? Does WMP really chooses a sequence at start and follows it. Once a change is encountered, it starts the sequence again after several songs. Is it so? Feel free to shoot it down. I don't know whether it's acceptable here. Just curious about it... Note: This is only observed when both shuffle and repeat are enabled. To confirm, I tried it in two other PCs of mine (thereby dumped 2 hours). BTW, I also didn't observe this magic in VLC, Winamp, K-Lite and not even my Nokia cellphone. I think I'm not a good Googler and so, I can't find any such issues :-)

    Read the article

  • Can I convert an existing Firefox installation to ESR without a re-install?

    - by Iszi
    It took some jumping through hoops (including a mailing list subscription that I apparently didn't need) but I finally found where to download the Firefox ESR. This is great for fresh installs, but I was wondering if there's a way to simply convert existing installations to the ESR configuration without having to do a full install. As I understand it, the only difference between ESR and regular Firefox will be how they receive updates. After the new standard version of Firefox comes out, ESR releases will only receive critical security updates and bug fixes for the remainder of their support life. Newer versions of Firefox's standard build will have all the latest and greatest features, while ESR releases are meant to provide stability for environments that can't be expected to keep up with a new full version number change as often as Mozilla does them. In regular Firefox, the About screen shows that I am using the "release" update channel. Is switching to ESR really just a matter of switching the update channel? I presume this can be done in about:config by changing app.update.channel and probably also app.update.url. However, I don't know what these values should be for ESR or if anything else should be tweaked. So, is it possible to switch to ESR without a reinstall and, if so, how? (Note: While this question was written originally for Firefox 10, I expect any answers will apply to future ESR versions as well.)

    Read the article

  • What steps to take when CPAN installation fails?

    - by pythonic metaphor
    I have used CPAN to install perl modules on quite a few occasions, but I've been lucky enough to just have it work. Unfortunately, I was trying to install Thread::Pool today and one of the required dependencies, Thread::Converyor::Monitored failed the test: Test Summary Report ------------------- t/Conveyor-Monitored02.t (Wstat: 65280 Tests: 89 Failed: 0) Non-zero exit status: 255 Parse errors: Tests out of sequence. Found (2) but expected (4) Tests out of sequence. Found (4) but expected (5) Tests out of sequence. Found (5) but expected (6) Tests out of sequence. Found (3) but expected (7) Tests out of sequence. Found (6) but expected (8) Displayed the first 5 of 86 TAP syntax errors. Re-run prove with the -p option to see them all. Files=3, Tests=258, 6 wallclock secs ( 0.07 usr 0.03 sys + 4.04 cusr 1.25 csys = 5.39 CPU) Result: FAIL Failed 1/3 test programs. 0/258 subtests failed. make: *** [test_dynamic] Error 255 ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz /usr/bin/make test -- NOT OK //hint// to see the cpan-testers results for installing this module, try: reports ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz Running make install make test had returned bad status, won't install without force Failed during this command: ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz: make_test NO What steps do you take to start seeing why an installation failed? I'm not even sure how to begin tracking down what's wrong.

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • should i link to a blog site or install my own blog engine?

    - by dc
    we're setting up a company blog. Our technology stack is .NET. Should we just use blogger/wordpress for the blog and redirect to it from our site? or should i install a blog engine directly on our site (e.g. blogEngine.NET)? some considerations i'd like feedback on are: 1.SEO - if you host your blog on wordpress/blogger instead of installing it on your site - will you get better page rankings? (if the content was the exact same) 2.scalability - i've read that dotNetBlogEngine doesnt scale well on web farms etc. our website is setup to be stateless. 3.security - presumably a hosted blog site has the advantage of having regular security updates. how easy is it to keep an installed blog engine patched? 4.examples of installed blog engines - dotNetBlogEngine seems to be the best but has a couple of limitations. can anyone suggest another one (n/a if you're advice is to host the blog on blogger/wordpress) 5.any other comments/issues/concerns we should be aware of? thanks for your feedback!

    Read the article

  • Does Antivirus2009 or Antivirus360 automatically install on your computer and if so how?

    - by sergey
    I run Firefox on Vista, and unfortunately I got tricked (through a deceptive google result) into going to a page containing one of those fake "Your Computer Has all of this Spyware on it!" pages. I tried manually closing the tab, but it had a "Are you sure you want to navigate away" JavaScript alerts (HATE THOSE). So I clicked "OK," and the tab closed. Then I closed firefox altogether and rebooted. Now, before I could close the tab, it did prompt me to download a file, but of course I choose not to, and checking my downloads folder, nothing new is there. Also, even if I ?did? download it, ?I? would still have to choose to run it by double clicking on it for it to install itself, right? Also, I ran Malware Bites and Windows Defender and both said everything was fine. From this I would normally believe I am safe, but I have read everywhere that this thing "automatically installs" itself and that it is a bitch to get rid of. Is it really possible for this thing to dig in if you are running firefox and didn't choose to download it or run it after downloading?

    Read the article

  • Use external display from boot on Samsung laptop

    - by OhMrBigshot
    I have a Samsung RV511 laptop, and recently my screen broke. I connected an external screen and it works fine, but only after Windows starts. I want to be able to use the external screen right from boot, in order to set the BIOS to boot from DVD, and to then install a different OS and also format the hard drive. Right now I can only use the screen when Windows loads. What I've tried: I've tried opening up the laptop and disconnecting the display to make it only find the external and use the VGA as default -- didn't work. I've tried using the Fn+key combo in BIOS to connect external display - nothing I've been looking around for ways to change boot sequence without entering BIOS, but it doesn't look like it's possible. Possible solutions? A way to change boot sequence without entering BIOS? Someone with the same brand/similar model to help me blindly keystroke the correct arrows/F5/F6 buttons while in BIOS mode to change boot sequence? A way to force the external display to work from boot, through modifying the internal connections (I have no problem taking the laptop apart if needed, please no soldering though), through BIOS or program? Also, if I change boot sequence without accessing external screen, would the Ubuntu 12.1 installation sequence attempt to use the external screen or would I only be able to use it after Linux is installed and running? I'd really appreciate help, I can't afford to fix the screen for a few months from now, and I'd really like to make my computer come back to decent performance! Thanks in advance!

    Read the article

  • Unix apt-get doesnt download from nfs locaiton

    - by pravesh
    I have switched to unix from last 3 months and trying to understand install process and in particular apt-get. I am able to successfully install and download the packages when I configure my repository on http location in /etc/apt/sources.list file. e.g. deb http://web.myspqce.com/u/eng/rose/debian-mirror-squeeze-amd64/mirror/ftp.us.debian.org/debian/ squeeze main contrib non-free This command will download(/var/cache/apt/archive) and install the package when i use apt-get install When I change the source location to file instead of http(nfs mount point), the package is getting installed but NOT getting downloaded in /var/cache/apt/archive. deb file:/deb_repository/debian-mirror-squeeze-amd64/mirror/ftp.us.debian.org/debian/ squeeze main contrib non-free Please let me know if there is any configuration or settings that i have to make to let apt-get to both download and install package when i use (nfs)file:/ instead of http:/ in sources.list. To achieve this, I can use apt-get --downlaod-only and then use apt-get install for both download and install in two separate calls, but I want to know why package is not getting downloaded with apt-get install but only getting installed when used with file:/ in sources.list

    Read the article

  • ERROR: Not enough space?

    - by dsmoljanovic
    Now this is a very unspecific question. I'm trying to figure out what this message would mean. Here is the story behind it: I'm installing Oracle enterprise manager cloud control (12c r3) on Solaris 10 (5/09). Installer opens up, i enter all needed information and at the last step click Install. It immediately crashes with only "ERROR: Not enough space" written in log and console and nothing else. Now, this could be java error or Solaris error? I'm thinking it's happening either when it starts to copy files or when it tries to launch a process that would do that. What space is it referring to? disk (have ehough), swap (also), memory (yep)... Any ideas are helpful. Edit: i found this exception in the oraInventory logs: oracle.sysman.oii.oiic.OiicInstallAPIException: Not enough space at oracle.sysman.oii.oiic.OiicAPIInstaller.initInstallSession(OiicAPIInstaller.java:2165) at oracle.sysman.oii.oiic.OiicAPIInstaller.initOUIAPISession(OiicAPIInstaller.java:790) at oracle.sysman.install.oneclick.EMGCOUIInstaller.prepareForInstall(EMGCOUIInstaller.java:676) at oracle.sysman.install.oneclick.EMGCSummaryDlgonNext$1.run(EMGCSummaryDlgonNext.java:243) at java.lang.Thread.run(Thread.java:662) at oracle.sysman.install.oneclick.EMGCSummaryDlgonNext.actionsOnClickofNext(EMGCSummaryDlgonNext.java:1067) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at oracle.sysman.install.oneclick.EMGCUtil.performonClickOfNextForClass(EMGCUtil.java:399) at oracle.sysman.install.oneclick.EMGCUtil.performPageLevelValidationsForSilentInstall(EMGCUtil.java:367) at oracle.sysman.install.oneclick.EMGCInstaller.prepareForSilentInstall(EMGCInstaller.java:1459) at oracle.sysman.install.oneclick.EMGCInstaller.main(EMGCInstaller.java:1553) disk status: bash-3.00$ df -h /tmp Filesystem size used avail capacity Mounted on swap 8.1G 2.7G 5.4G 33% /tmp bash-3.00$ df -h /u01 Filesystem size used avail capacity Mounted on / 275G 28G 244G 11% / swap: root@gs12emcc # swap -s total: 18306040k bytes allocated + 3837808k reserved = 22143848k used, 5712664k available

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • Dual hard drive Windows 7 system, modified the registry to get programs to install on second drive, now IE doesn't work

    - by paul
    I have a dual hard drive Windows 7 system, Windows is installed on an SSD (C:) and I modified the registry to try to force programs to install on second HDD drive (another letter). The registry edits are pretty simple, just a few keys in HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\Windows\CurrentVersion to change the drive letter. For the most part the system is very fast and works great, but IE doesn't work anymore. With IE10, it opens for a flash with a white window then closes. I tried installed IE11 which opens a white window for a few seconds, doesn't respond, then crashes. I've tried all the solutions I could find. This includes resetting the IE settings, "uninstalling" and re-installing IE, which is just turning it on and off in "Turn Windows Features on or off", copying the Program Files\Internet Explorer files onto both/either drives, changing the registry keys back to use C:, lots of rebooting, and safe mode. Nothing has worked. I don't see errors in the event viewer, but I might not know what to look for. Any ideas on how to get IE running? I don't need IE for daily browsing, I just need it for cross-browser testing on sites I build and on the rare occasion a page only works in IE. I don't really want to use a virtual machine, but would be ok with something standalone like tredosoft's, but I'm not aware of something like that for current versions of IE.

    Read the article

  • How do I install Photoshop CS2 in Wine w/ Creative Suite Installer?

    - by kellishaver
    I'm running Ubuntu 9.10 and wanted to install Photoshop CS2 in Wine (wine1.2). From what I've read, the Photoshop installer and application should both run fine. However, I don't have a specific installer for Photoshop. The setup program on the CD is for the entire Creative Suite 2 bundle. When I try to run it, I get through the splash screen, license agreement, and language selection screens, but when I click the button to start/customize the installation, the installer dies. The Photoshop CS 2 folder on the CD has two exe files, instmsia.exe and instmsiw.exe, and I tried those, hoping to find a stand-alone Photoshop installer, but neither work. I tried downloading a trial, but my license key is apparently for the entire bundle, because it didn't work. Does anyone know of a work-around for this or a way to make the Creative Suite installer work? I'm currently running Photoshop under a WinXP VM, but it would be nice to have the option of using it via Wine, so I don't have to boot the VM every time I want to edit an image (and also reading/writing to my Ubuntu shares is really slow in Virtualbox). Thanks!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How do I install gfortran (via cygwin and etexteditor) and enable ifort under Windows XP?

    - by bez
    I'm a newbie in the Unix world so all this is a little confusing to me. I'm having trouble compiling some Fortran files under Cygwin on Windows XP. Here's what I've done so far: Installed the e text editor. Installed Cygwin via the "automatic" option inside e text editor. I need to compile some Fortran files so via the "manage bundles" option I installed the Fortran bundle as well. However, when I select "compile single file" I get an error saying gfortran was missing, and then that I need to set the TM_FORTRAN variable to the full path of my compiler. I tried opening a Cygwin bash shell at the path mentioned (.../bin/gfortran), but the compiler was nowhere to be found. Can someone tell me how to install this from the Cygwin command line? Where do I need to update the TM_FORTRAN variable for the bundle to work? Also, how do I change the bundle "compile" option to work with ifort (my native compiler) on Windows? I've read the bundle file, but it is totally incomprehensible to me. Ifort is a Windows compiler, invoked simply by ifort filename.f90, since it is on the Windows path. I know this is a lot to ask of a first time user here, but I really would appreciate any time you can spare to help.

    Read the article

  • Do I need to install mssql before I can use mssql.so with php on unix?

    - by lock
    I didn't install any MSSQL instance on my localhost that runs windows. I just used the xampp package and uncommented the modules used for mssql. The mssql server resides on another Windows Server so I believe I only needed a simple connector module. I hoped that it would be the same for Unix. But whenever I open my site on the unix production server, (i use codeigniter btw) the logs tell me it stops script execution after Database Driver Class Initialized. I am not really familiar on installing apache and friends on unix and I wasn't responsible on how the server was set-up. But it turns out that there is no mssql.so found on the php modules directory so i tried to google for one. While the forums are telling me to just compile the script, I couldn't just do that simply as I have no write access to the server and plus it seems upon installation of php, phpize didn't get installed with it too. Hope someone can shed light to me regarding this. I think its just easier if I can get a mssql.so for PHP 4.4.4

    Read the article

  • Can't install flash on Firefox or Chrome (but works fine on IE...)

    - by WP
    I'm using a work computer (Lenovo) that I recently got from my IT department to replace an old machine. When I installed Firefox and Chrome, I needed to install Adobe Flash. However, the installation has failed on several occasions. I've taken all the usual steps: closing all programs and windows, installing updates and restarting machine, etc, but still the installation does not work. The download manager and status bars say that installation is complete, but I still can't view flash sites on FF or Chrome. Flash is working fine on IE though. Last thing: when I reboot the first dialog box that comes up is from Adobe Download Manager, and it says "Please shut down Internet Explorer before uninstall can complete". I'm confused since a) I've just rebooted so have yet to start IE and b) why UNinstall? My company does not support non-IE browsers so I'm not getting much help from our IT department. If necessary I can post screenshots of error messages and stuff if it comes to that, but hopefully someone will be able to diagnose the problem before that's necessary as I'm not the most tech savvy (despite being a huge fan of reddit...)

    Read the article

  • Defining recursive algebraic data types in XML XSD

    - by Ben Challenor
    Imagine I have a recursive algebraic data type like this (Haskell syntax): data Expr = Zero | One | Add Expr Expr | Mul Expr Expr I'd like to represent this in XML, and I'd like an XSD schema for it. I have figured out how to achieve this syntax: <Expr> <Add> <Expr> <Zero/> </Expr> <Expr> <Mul> <Expr> <One/> </Expr> <Expr> <Add> <Expr> <One/> </Expr> <Expr> <One/> </Expr> </Add> </Expr> </Mul> </Expr> </Add> </Expr> with this schema: <xs:complexType name="Expr"> <xs:choice minOccurs="1" maxOccurs="1"> <xs:element minOccurs="1" maxOccurs="1" name="Zero" type="Zero" /> <xs:element minOccurs="1" maxOccurs="1" name="One" type="One" /> <xs:element minOccurs="1" maxOccurs="1" name="Add" type="Add" /> <xs:element minOccurs="1" maxOccurs="1" name="Mul" type="Mul" /> </xs:choice> </xs:complexType> <xs:complexType name="Zero"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="One"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="Add"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> <xs:complexType name="Mul"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> But what I really want is this syntax: <Add> <Zero/> <Mul> <One/> <Add> <One/> <One/> </Add> </Mul> </Add> Is this possible? Thanks!

    Read the article

  • DataTable ReadXmlSchema and ReadXml Resulting in error

    - by MasterMax1313
    I'm having some trouble with the ReadXmlSchema and ReadXml methods for a DataTable. I'm getting the error "DataTable does not support schema inference from Xml". Code Snippet: I've tried Table.ReadXmlSchema(new StringReader(File.ReadAllText(XsdFilePath))); Table.ReadXml(new StringReader(File.ReadAllText(XmlFilePath))); And Table.ReadXmlSchema(XsdFilePath); Table.ReadXml(XmlFilePath); Xml Snippet: <ScreenSets> <ScreenSet id="Credit 1"> <Screen xmlFile="sb-credit1.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 2"> <Screen xmlFile="sb-credit2.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 3"> <Screen xmlFile="sb-credit3.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> </ScreenSets> Xsd: <?xml version="1.0" encoding="utf-8"?> <xs:schema attributeFormDefault="unqualified" elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="ScreenSets"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="ScreenSet"> <xs:complexType> <xs:sequence> <xs:element name="Screen"> <xs:complexType> <xs:sequence> <xs:element name="Buttons"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="Button"> <xs:complexType> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="xmlFile" type="xs:string" use="required" /> <xs:attribute name="tabText" type="xs:string" use="required" /> <xs:attribute name="isCached" type="xs:boolean" use="required" /> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:schema>

    Read the article

  • Resolve naming conflict in included XSDs for JAXB compilation

    - by Jason Faust
    I am currently trying to compile with JAXB (IBM build 2.1.3) a pair of schema files into the same package. Each will compile on it's own, but when trying to compile them together i get a element naming conflict due to includes. My question is; is there a way to specify with an external binding a resolution to the naming collision. Example files follow. In the example the offending element is called "Common", which is defined in both incA and incB: incA.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeA"> <sequence> <element name="ElementA" type="string"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeA"></element> </schema> incB.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeB"> <sequence> <element name="ElementB" type="int"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeB"></element> </schema> A.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incA.xsd"></include> <complexType name="A"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> B.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incB.xsd"></include> <complexType name="B"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> Compiler error when both are compiled from one evocation of xjb: [ERROR] 'Common' is already defined line 9 of file:/C:/temp/incB.xsd [ERROR] (related to above error) the first definition appears here line 9 of file:/C:/temp/incA.xsd (For reference, this is a generalization to resolve an issue with compiling the OAGIS8 SP3 package)

    Read the article

  • Cross platform application revolution

    - by anirudha
    Every developer know that if they make a windows application that they work only on windows. that’s a small pity thing we all know. this is a lose point for windows application who make developer thing small means only for windows and other only for mac. this is a big point behind success of web because who purchase a operating system if they want to use a application on other platform. why they purchase when they can’t try them. that’s a thing better in Web means IE 6 no problem IE 6 to IE 8 chrome to chrome 8 Firefox to Firefox 3.6.13 even that’s beta no problem the good website is shown as same as other browser. some minor difference may be can see. the cross platform application development thinking is much big then making a application who is only for some audience. the difference between audience make by OS what they use Windows or mac. if they use mac they can’t use this they use windows they can’t use this. Web for Everyone starting from a children to grandfather. male and female Everyone can use internet.no worrying what you have even you have Windows or mac , any browser even as silly IE 6. the cross platform have a good thing that “People”. everyone can use them without a problem that. just like some time problem come in windows that “some component is missing click here to get them” , you can’t use this [apps] software because you have windows sp1 , sp2  sp3. you need to install this first before this. this stupidity mainly comes in Microsoft software. in last year i found a issue on WPI that they force user to install another software when they get them from WPI. ex:- you need to install Visual studio 2008 before installing Visual studio 2010 express. are anyone tell me why user get old version 2008 when they get latest and express version. i never try again their to check the issue is solved or not. a another thing is you can’t get IE 9 on windows XP version. in that’case don’t thing and worrying about them because Firefox and Chrome is much better. the stupidity from Microsoft is too much. they never told you about Firebug even sometime they discuss about damage tool in IE they called them developer tool because they are Microsoft and they only thing how they can market their products. you need to install many thing without any reason such as many SQL server component even you use other RDBMS. you can’t say no to them because you need a tool and tool require a useless component called SQL server. i never found any software force me to install this for this and this for this before install me. that’s another good thing in WEB that no thing require i means you not need to install dotnet framework 4 before enjoy facebook or twitter. may be you found out that Microsoft's fail project Window planet force you to get silverlight before going their. i never hear about them. some month ago my friend talked to me about them i found nothing better their. Wha’t user do when facebook force user to install silverlight or adobe flash or may be Microsoft dotnet framework 4. if you not install them facebook tell  you bye bye tata ! never come here before installing Microsoft dotnet framework 4. the door is open for you after installing them not before. the story is same as “ tell me sorry before coming in home” as mother says to their child when they do something wrong. the web never force you to do something for them. sometime they allow you to use other website account their that’s very fast login for you. because they know the importance of your time.

    Read the article

  • Alternate method to dependent, nested if statements to check multiple states

    - by octopusgrabbus
    Is there an easier way to process multiple true/false states than using nested if statements? I think there is, and it would be to create a sequence of states, and then use a function like when to determine if all states were true, and drop out if not. I am asking the question to make sure there is not a preferred Clojure way to do this. Here is the background of my problem: I have an application that depends on quite a few input files. The application depends on .csv data reports; column headers for each report (.csv files also), so each sequence in the sequence of sequences can be zipped together with its columns for the purposes of creating a smaller sequence; and column files for output data. I use the following functions to find out if a file is present: (defn kind [filename] (let [f (File. filename)] (cond (.isFile f) "file" (.isDirectory f) "directory" (.exists f) "other" :else "(cannot be found)" ))) (defn look-for [filename expected-type] (let [find-status (kind-stat filename expected-type)] find-status)) And here are the first few lines of a multiple if which looks ugly and is hard to maintain: (defn extract-re-values "Plain old-fashioned sub-routine to process real-estate values / 3rd Q re bills extract." [opts] (if (= (utl/look-for (:ifm1 opts) "f") 0) ; got re columns? (if (= (utl/look-for (:ifn1 opts) "f") 0) ; got re data? (if (= (utl/look-for (:ifm3 opts) "f") 0) ; got re values output columns? (if (= (utl/look-for (:ifm4 opts) "f") 0) ; got re_mixed_use_ratio columns? (let [re-in-col-nams (first (utl/fetch-csv-data (:ifm1 opts))) re-in-data (utl/fetch-csv-data (:ifn1 opts)) re-val-cols-out (first (utl/fetch-csv-data (:ifm3 opts))) mu-val-cols-out (first (utl/fetch-csv-data (:ifm4 opts))) chk-results (utl/chk-seq-len re-in-col-nams (first re-in-data) re-rec-count)] I am not looking for a discussion of the best way, but what is in Clojure that facilitates solving a problem like this.

    Read the article

  • Sorting Algorithm : output

    - by Aaditya
    I faced this problem on a website and I quite can't understand the output, please help me understand it :- Bogosort, is a dumb algorithm which shuffles the sequence randomly until it is sorted. But here we have tweaked it a little, so that if after the last shuffle several first elements end up in the right places we will fix them and don't shuffle those elements furthermore. We will do the same for the last elements if they are in the right places. For example, if the initial sequence is (3, 5, 1, 6, 4, 2) and after one shuffle we get (1, 2, 5, 4, 3, 6) we will keep 1, 2 and 6 and proceed with sorting (5, 4, 3) using the same algorithm. Calculate the expected amount of shuffles for the improved algorithm to sort the sequence of the first n natural numbers given that no elements are in the right places initially. Input: 2 6 10 Output: 2 1826/189 877318/35343 For each test case output the expected amount of shuffles needed for the improved algorithm to sort the sequence of first n natural numbers in the form of irreducible fractions. I just can't understand the output.

    Read the article

  • Can I install SQL Server 2008 R2 on a Windows Server 2008 R2 Standard machine in a workgroup then join the server to a domain?

    - by Zero Subnet
    I have a Windows 2008 Server Standard x64 machine that I need to install SQL Server 2008 R2 Standard on then ship it to a different site where it will be joined to a Active Directory domain. The server is now using the default "WORKGROUP" workgroup and i need to know if i can install SQL Server on it then ship it to the other site where it will be joined to the domain without issues. What are the possible problems that could happen? are there any workarounds?

    Read the article

< Previous Page | 178 179 180 181 182 183 184 185 186 187 188 189  | Next Page >