Search Results

Search found 23657 results on 947 pages for 'install sequence'.

Page 192/947 | < Previous Page | 188 189 190 191 192 193 194 195 196 197 198 199  | Next Page >

  • How can I dual install Ubuntu 10.4 in a Mac Mini with 10.4.11?

    - by Marco Mariani
    I'd like to power-up my aging Mac Mini (1.5GHz Core Solo, 1GB RAM, Tiger 10.4.11) by installing a shiny Ubuntu alongside the current OS. After all, I use Ubuntu for everything save for cleaning my teeth. Since it's my first and only Mac and I have next to no experience with the OS (having used it basically as a media player) I am a little concerned about rEFIt, ELILO, Boot Camp and the fact that it's basically a 4.5 years old unsupported machine and I might get asleep reinstalling everything several times. I've used the live desktop-i386 CD and everything works. I tried with an external USB drive instead of a CD but couldn't make it boot. As for installing Ubuntu, the howtos I've found give several alternatives depending on the model, the OSX version, etc.. but they usually talk about newer machines. Which howto should I follow to repartition, and boot thereafter? Thanks

    Read the article

  • Can somebody help me install this jBPM based workflow management suite?

    - by Eternal Saint
    1.Its a book Workflow Interface software available at sourceforge http://bookworkflowint.sourceforge.net/ Any instructions on installing and configuring it would be great especially in windows, however I can try Linux specific ones as well. I could not find any installation instructions. I posted this in stackoverflow by mistake and was directed here. 2.Can you guys suggest any good scanning/digitization workflow software (document imaging) that I can adopt to my scanner software? Infact even a simple one would do may be based on hotfolders. I just want to be able to track the uniqueid/barcode of the scanned book, its status so that its not scanned again. It books or manuscripts could be in millions page count. I thought of using some kind of generic bug tracking tool, just track a few fields, dont know if its the right choice Thank you very much

    Read the article

  • I want to install and get to building a personal MySQL DB on 64 bit Ubuntu [closed]

    - by Ari Hall
    So how do I go from installing MySQL from the Software Center to inputing data into fields and bringing in a comma delimited file? I've only had brief experience with MSAccess and OOo Base a long time ago, so details are appreciated, I just want to get up and running. I have Ubuntu 10.10, 64 bit, if that affects much. If you can link me to a howto that does exactly what I'm looking for, that would work. Again, Thanks!

    Read the article

  • Iterator blocks in Clojure?

    - by Checkers
    I am using clojure.contrib.sql to fetch some records from an SQLite database. (defn read-all-foo [] (with-connection *db* (with-query-results res ["select * from foo"] (into [] res)))) Now, I don't really want to realize the whole sequence before returning from the function (i.e. I want to keep it lazy), but if I return res directly or wrap it some kind of lazy wrapper (for example I want to make a certain map transformation on result sequence), SQL-related bindings will be reset and connection will be closed after I return, so realizing the sequence will throw an exception. How can I enclose the whole function in a closure and return a kind of iterator block (like yield in C# or Python)? Or is there another way to return a lazy sequence from this function?

    Read the article

  • db:migrate creates sequences but doesn't alter table?

    - by RewbieNewbie
    Hello, I have a migration that creates a postres sequence for auto incrementing a primary identifier, and then executes a statement for altering the column and specifying the default value: execute 'CREATE SEQUENCE "ServiceAvailability_ID_seq";' execute <<-SQL ALTER TABLE "ServiceAvailability" ALTER COLUMN "ID" set DEFAULT NEXTVAL('ServiceAvailability_ID_seq'); SQL If I run db:migrate everything seems to work, in that no errors are returned, however, if I run the rails application I get: Mnull value in column "ID" violates not-null constraint I have discovered by executing the sql statement in the migration manually, that this error is because the alter statement isn't working, or isn't being executed. If I manually execute the following statement: CREATE SEQUENCE "ServiceAvailability_ID_seq; I get: error : ERROR: relation "serviceavailability_id_seq" already exists Which means the migration successfully created the sequence! However, if I manually run: ALTER TABLE "ServiceProvider" ALTER COLUMN "ID" set DEFAULT NEXTVAL('ServiceProvider_ID_seq'); SQL It runs successfully and creates the default NEXTVAL. So the question is, why is the migration file creating the sequence with the first execute statement, but not altering the table in the second execute? (Remembering, no errors are output on running db:migrate) Thank you and apologies for tl:dr

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What to do with a broken OS X install disc?

    - by slhck
    First things first: I don't appreciate software piracy and I really want to spend money on software that I use and that I work and make money with. I don't want this question closed just because I consider downloading software, I only want honest opinions and alternatives. Here we go: So I have my OS X Snow Leopard Upgrade DVD, but it's horribly scratched and won't boot anymore. It endlessly loads and at some point I have to force pull it out of the disc slot. How can I reset my Mac then? Can I take my original disk to an Apple Store and ask them for a replacement? Will they believe me, even if I don't have the receipt anymore? Would owning the original disk make it okay for me to look somewhere on the internet and download it? I don't even know if that will work without hassles. Could I try to read the disk to an image with some error correction methods? Maybe during boot it can't read some files, but some other program can? Is there any other way of resetting the Mac? Mine's now over 3 years old an I seem to have misplaced my original discs that had 10.4 on it. Or should I just buy a new 10.6 upgrade disk? (Which is not really what I want to do) Answers and opinions would be much appreciated.

    Read the article

  • How to install/configure ffmpeg to compress mp4 videos for flash player delivery?

    - by Andrew Fulton
    We have a flash web-app that created interactive video, and are using ffmpeg to do some compression/resizing when a user "publishes" their project. The user can upload flv files and mp4 files, both of which play fine in the Flash UI before publishing. After publishing the flv files work fine, but the mp4 files will not play in the flash player: Audio will play but video won't. The mp4 files will play fine if I download them and play them in the Quicktime player but if I attempt to open them in the Adobe Media Player it reports "The media file does not contain a supported video track". If I open the Movie inspector in quicktime it tells me that the original file is an "h264" video and the ffmpeg-processed ones are "mpeg-4". I have tried forcing it to h264 by adding flags like -f h264 and -vcodec h264 but I get a screenfull of errors (no frame, illegal POC type, sps_id out of range) ending with Could not find codec parameters (Video: h264) h264 will show up if I run ffmpeg -formats and ffmpeg -codecs, and as I said it will play fine in Quicktime. Is there anything else I need to do to convince the flash player to play them? Is there anything else I need to tell you about the server that will help?

    Read the article

  • How to install the TRIM RAID update for the Intel storage controller?

    - by Mike Pateras
    I just found this article, that says that Intel now supports TRIM for SSDs when the Intel storage controller is in RAID mode. It links to this download page. I'm pretty excited about that, but I'm a little confused. There seem to be two sets of drivers, an executable and something that's bootable. I ran the executable. Is that just to apply the drivers to my system now, and are the bootable drivers so that if I re-format, I won't have to re-run everything? Do I need to do both? And is there a way to check if it worked? I'm running an i7 in Windows 7 (ASUS P6T Deluxe Motherboard) with RAID 0, if that's significant.

    Read the article

  • Fresh install of 64bit Ubuntu needs flash but adobe doesn't have a version for me.

    - by DJTripleThreat
    I need flash to watch YT videos. YT said "You need to upgrade your Adobe Flash Player to watch this video." with a link to download flash. I'm running 10.04 so I see possible choices for myself: 1) a .deb file for Ubuntu 8.04+ or APT (whats this??) for Ubuntu 9.04. I downloaded the deb file and when I opened it in the installer it said that I have the wrong architecture. Anyone have an idea about how to work around this?

    Read the article

  • Possible to install Xmonad on Ubuntu separate from Gnome?

    - by Kurtosis
    I just downloaded Xmonad from the repository on my Ubuntu 10.04 box, but when I log out and try to log back in using Xmonad instead Gnome, it doesn't work. I just get the login screen background image and a mousepointer, and nothing else. Right-clicking does nothing, no menus or anything. Key combo's like Ctrl-X, Ctrl-Z, and Ctrl-Alt-Delete do nothing either. Left the computer in this state for 30 minutes while I went to the grocery store, but it was still hung when I returned and I had to hard-reboot it. A Google search returned a few sites showing how to configure Xmonad to work with Gnome, but I'm afraid to try this since I don't want to risk borking my Gnome installation, at least not until I've had a chance to learn Xmonad a bit. Is it possible to run Xmonad independently of Gnome? If so, anyone have any idea what might be wrong and how to fix it?

    Read the article

  • Is this code well-defined?

    - by Nawaz
    This code is taken from a discussion going on here. someInstance.Fun(++k).Gun(10).Sun(k).Tun(); Is this code well-defined? Is ++k Fun() evaluated before k in Sun()? What if k is user-defined type, not built-in type? And in what ways the above function calls order is different from this: eat(++k);drink(10);sleep(k); As far as I can say, in both situations, there exists a sequence point after each function call. If so, then why can't the first case is also well-defined like the second one? Section 1.9.17 of the C++ ISO standard says this about sequence points and function evaluation: When calling a function (whether or not the function is inline), there is a sequence point after the evaluation of all function arguments (if any) which takes place before execution of any expressions or statements in the function body. There is also a sequence point after the copying of a returned value and before the execution of any expressions outside the function.

    Read the article

  • Another serialization ? - c#

    - by ltech
    I had asked this Yesterday If my xsd schema changes to <xs:element name="Document" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="MetaDoc" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="ATTRIBUTES" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="author" type="xs:string" minOccurs="0" /> <xs:element name="max_versions" type="xs:string" minOccurs="0" /> <xs:element name="summary" type="xs:string" minOccurs="0" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> My xsd - class generation becomes /// <remarks/> [System.Xml.Serialization.XmlArrayAttribute(Form=System.Xml.Schema.XmlSchemaForm.Unqualified)] [System.Xml.Serialization.XmlArrayItemAttribute("MetaDoc", typeof(DocumentMetaDocATTRIBUTES[]), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false)] [System.Xml.Serialization.XmlArrayItemAttribute("ATTRIBUTES", typeof(DocumentMetaDocATTRIBUTES), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false, NestingLevel=1)] public DocumentMetaDocATTRIBUTES[][][] Document { get { return this.documentField; } set { this.documentField = value; } } If I am deriving to CollectionBase, as shown in my previous post, how would I manage the XmlArrayItemAttribute ? so that I can read this part of my input xml into my strongly types object <Document> <MetaDoc> <ATTRIBUTES> <author>asas</author> <max_versions>1</max_versions> <summary>aasasqqqq</summary> </ATTRIBUTES> </MetaDoc> </Document>

    Read the article

  • SSD install - what do I need to watch out for when reconfiguring SATA ports?

    - by tim11g
    I installed a Samsung 840 SSD in a Windows 7 machine. It seems to be working fine, but I'm not seeing the expected performance. The AS SSD benchmark gives 76 for read and 138 for write. At the upper left of the benchmark it says "pciide - BAD" and "31K - BAD". I'm assuming the "pciide BAD" means the motherboard (Gigabyte GA-P35-DS4) is configured as IDE emulation and needs to change to native SATA. I don't know what the "31K" refers to. The bios settings look like this: I saw this article that indicates that changing the SATA mode of the boot drive can cause problems (Blue Screen): Error message occurs after you change the SATA mode of the boot drive What is the correct procedure to change the SATA Mode without causing a system failure? Apply the registry change from the MSFT article above first, then reboot and change the SATA mode? Will the SATA mode change in the BIOS affect other drives?

    Read the article

  • Swift CMutablePointers in factories e.g. NewMusicSequence

    - by Gene De Lisa
    How do you use C level factory methods in Swift? Let's try using a factory such as NewMusicSequence(). OSStatus status var sequence:MusicSequence status=NewMusicSequence(&sequence) This errors out with "error: variable 'sequence' passed by reference before being initialized". Set sequence to nil, and you get EXC_BAD_INSTRUCTION. You can try being explicit like this: var sp:CMutablePointer<MusicSequence>=nil status=NewMusicSequence(sp) But then you get a bad access exception when you set sp to nil. If you don't set sp, you get an "error: variable 'sp' used before being initialized" Here's the reference.

    Read the article

  • What Linux distro should I install on an old PowerPC Mac?

    - by rockit
    I'm trying to set up my brother–who has a PPC Mac with 1 GHz processor and 256 MB RAM–with a Linux distro that would allow him to surf the web on the device. If anyone knows of this Mac, they also know that support has faded for the latest browsers, rendering the device essentially useless when it comes to the web. Ideally I would have installed Jolicloud, but alas, it is only Intel Mac compatible... Please let me know if you have any suggestions for me!

    Read the article

  • How do I install and run Tomcat on port 80 as my only web server? (Rooted Ubuntu box)

    - by gav
    Hi All, tl;dr - I have a rooted linux box that I want to run tomcat on as a server (No Apache Web Server) how would you set this up avoiding common security pitfalls? I've written a Grails App that I want to run on a VPS I rent. The VPS has very little memory and I am using it for the sole purpose of running this application so I don't need the apache web server. This is my first venture into Server administration and I'm sure to fall into some well known traps. Should I use iptables to redirect requests from port 80 to 8080? Should I run tomcat as root or as it's own user? What configuration settings would be good for a low memory system expecting less than 10 concurrent users? Hopefully an easy one for you! Anyone who could link to a tutorial would be a personal hero destined for great things no doubt. Gav

    Read the article

  • Scapy install issues. Nothing seems to actually be installed?

    - by Chris
    I have an apple computer running Leopard with python 2.6. I downloaded the latest version of scapy and ran "python setup.py install". All went according to plan. Now, when I try to run it in interactive mode by just typing "scapy", it throws a bunch of errors. What gives! Just in case, here is the FULL error message.. INFO: Can't import python gnuplot wrapper . Won't be able to plot. INFO: Can't import PyX. Won't be able to use psdump() or pdfdump(). ERROR: Unable to import pcap module: No module named pcap/No module named pcapy ERROR: Unable to import dnet module: No module named dnet Traceback (most recent call last): File "/Library/Frameworks/Python.framework/Versions/2.6/lib/python2.6/runpy.py", line 122, in _run_module_as_main "__main__", fname, loader, pkg_name) File "/Library/Frameworks/Python.framework/Versions/2.6/lib/python2.6/runpy.py", line 34, in _run_code exec code in run_globals File "/Users/owner1/Downloads/scapy-2.1.0/scapy/__init__.py", line 10, in <module> interact() File "scapy/main.py", line 245, in interact scapy_builtins = __import__("all",globals(),locals(),".").__dict__ File "scapy/all.py", line 25, in <module> from route6 import * File "scapy/route6.py", line 264, in <module> conf.route6 = Route6() File "scapy/route6.py", line 26, in __init__ self.resync() File "scapy/route6.py", line 39, in resync self.routes = read_routes6() File "scapy/arch/unix.py", line 147, in read_routes6 lifaddr = in6_getifaddr() File "scapy/arch/unix.py", line 123, in in6_getifaddr i = dnet.intf() NameError: global name 'dnet' is not defined

    Read the article

  • win7 64 bit. Fresh install on fresh pc fails with BSOD.

    - by 0plus1
    Hello, I've built a new machine: ASUS M4A785TD-V EVO OCZ DDR3 PC3-12800 (2x 2gb) Amd Athlon II X4 630 Box AM3 I tried memtest with hiren boot cd (tested only 3gb) and showed no error. Then I tried the built in ram test from the win7 cd (2 passes no errors). I also deleted with a 0 pass the hard drive. The error I get is this: 0x0000007e (0xFFFFFFFFFC0000005,0xFFFFF8000C1AB0F3,0xFFFFF880009A8498,0xFFFFF880009A7CF0) Any help is greatly appreciated. Thank you!

    Read the article

  • I am confused -- Will this code always work?

    - by Shekhar
    Hello, I have written this piece of code public class Test{ public static void main(String[] args) { List<Integer> list = new ArrayList<Integer>(); for(int i = 1;i<= 4;i++){ new Thread(new TestTask(i, list)).start(); } while(list.size() != 4){ // this while loop required so that all threads complete their work } System.out.println("List "+list); } } class TestTask implements Runnable{ private int sequence; private List<Integer> list; public TestTask(int sequence, List<Integer> list) { this.sequence = sequence; this.list = list; } @Override public void run() { list.add(sequence); } } This code works and prints all the four elements of list on my machine. My question is that will this code always work. I think there might be a issue in this code when two/or more threads add element to this list at the same point. In that case it while loop will never end and code will fail. Can anybody suggest a better way to do this? I am not very good at multithreading and don't know which concurrent collection i can use? Thanks Shekhar

    Read the article

< Previous Page | 188 189 190 191 192 193 194 195 196 197 198 199  | Next Page >