Search Results

Search found 20663 results on 827 pages for 'multiple inheritance'.

Page 194/827 | < Previous Page | 190 191 192 193 194 195 196 197 198 199 200 201  | Next Page >

  • Configuring multiple WCF binding configurations for the same scheme doesn't work

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" bindingConfiguration="public" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" bindingConfiguration="public" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • How to configurie multiple distinct WCF binding configurations for the same scheme

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • Linker errors between multiple projects in Visual C++

    - by rlbond
    Hi, I have a solution with multiple projects. I have a "main" project, which acts as a menu and from there, the user can access any of the other projects. On this main project, I get linker errors for every function called. How do I avoid these linker errors? I set the project dependencies already in the "Project Dependencies..." dialog. Thanks EDIT -- I did as suggested and added the output folder to the linker's additional directories. Now, however, I get a million errors as follows: 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_ios ::setstate(int,bool)" (?setstate@?$basic_ios@DU?$char_traits@D@std@@@std@@QAEXH_N@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::width(int)" (?width@ios_base@std@@QAEHH@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::basic_streambuf ::sputn(char const *,int)" (?sputn@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEHPBDH@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static bool __cdecl std::char_traits::eq_int_type(int const &,int const &)" (?eq_int_type@?$char_traits@D@std@@SA_NABH0@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static int __cdecl std::char_traits::eof(void)" (?eof@?$char_traits@D@std@@SAHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::basic_streambuf ::sputc(char)" (?sputc@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEHD@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_streambuf * __thiscall std::basic_ios ::rdbuf(void)const " (?rdbuf@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEPAV?$basic_streambuf@DU?$char_traits@D@std@@@2@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: char __thiscall std::basic_ios ::fill(void)const " (?fill@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEDXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::flags(void)const " (?flags@ios_base@std@@QBEHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::width(void)const " (?width@ios_base@std@@QBEHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static unsigned int __cdecl std::char_traits::length(char const *)" (?length@?$char_traits@D@std@@SAIPBD@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_ostream & __thiscall std::basic_ostream ::flush(void)" (?flush@?$basic_ostream@DU?$char_traits@D@std@@@std@@QAEAAV12@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_ostream * __thiscall std::basic_ios ::tie(void)const " (?tie@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEPAV?$basic_ostream@DU?$char_traits@D@std@@@2@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: bool __thiscall std::ios_base::good(void)const " (?good@ios_base@std@@QBE_NXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_ostream ::_Osfx(void)" (?_Osfx@?$basic_ostream@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_streambuf ::_Lock(void)" (?_Lock@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_streambuf ::_Unlock(void)" (?_Unlock@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::locale::facet * __thiscall std::locale::facet::_Decref(void)" (?_Decref@facet@locale@std@@QAEPAV123@XZ) already defined in panels.lib(panel_main.obj) 3libcpmtd.lib(ios.obj) : error LNK2005: "private: static void __cdecl std::ios_base::_Ios_base_dtor(class std::ios_base *)" (?_Ios_base_dtor@ios_base@std@@CAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(ios.obj) : error LNK2005: "public: static void __cdecl std::ios_base::_Addstd(class std::ios_base *)" (?_Addstd@ios_base@std@@SAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "void __cdecl _AtModuleExit(void (__cdecl*)(void))" (?_AtModuleExit@@YAXP6AXXZ@Z) already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: __Fac_tidy already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static void __cdecl std::locale::facet::facet_Register(class std::locale::facet *)" (?facet_Register@facet@locale@std@@CAXPAV123@@Z) already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static class std::locale::_Locimp * __cdecl std::locale::_Getgloballocale(void)" (?_Getgloballocale@locale@std@@CAPAV_Locimp@12@XZ) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static class std::locale::_Locimp * __cdecl std::locale::_Init(void)" (?_Init@locale@std@@CAPAV_Locimp@12@XZ) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "public: static void __cdecl std::_Locinfo::_Locinfo_ctor(class std::_Locinfo *,class std::basic_string,class std::allocator const &)" (?_Locinfo_ctor@_Locinfo@std@@SAXPAV12@ABV?$basic_string@DU?$char_traits@D@std@@V?$allocator@D@2@@2@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "public: static void __cdecl std::_Locinfo::_Locinfo_dtor(class std::_Locinfo *)" (?_Locinfo_dtor@_Locinfo@std@@SAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(xlock.obj) : error LNK2005: "public: __thiscall std::_Lockit::_Lockit(int)" (??0_Lockit@std@@QAE@H@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(xlock.obj) : error LNK2005: "public: __thiscall std::_Lockit::~_Lockit(void)" (??1_Lockit@std@@QAE@XZ) already defined in msvcprtd.lib(MSVCP90D.dll)

    Read the article

  • XSD Schema for XML with multiple structures

    - by Xetius
    I am attempting to write an XML Schema to cover a number of XML conditions which I may encounter. I have the same root element (serviceRequest) with different child elements. I was trying to use the xs:extension element to define multiple versions, but it is complaining about unexpected element orderInclusionCriteria etc. Am I going about this the right way, or is there a better way to define this? The other way I thought about this was to have a single xs:choice with all the options inside it, but this seemed somewhat inelegant. These XSD files are for use within XMLBeans if that makes any difference. I have Given the following 2 examples of XML: 1) <?xml version="1.0" encoding="utf-8"?> <serviceRequest method="GOO" debug="NO"> <sessionId sID="ABC1234567" /> <orderInclusionCriteria accountId="1234567" accountNum="1234567890" /> </serviceRequest> 2) <?xml version="1.0" encoding="utf-8"?> <serviceRequest method="GOO" debug="NO"> <sessionId sID="ABC1234567" /> <action aType='MakePayment'> <makePayment accountID='CH91015165S' amount='5.00' /> </action> </serviceRequest> I thought I could use the following schema file: <?xml version="1.0" encoding="UTF-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="serviceRequest" type="ServiceRequestType" /> <xs:element name="session" type="SessionType" /> <xs:attribute name="method" type="xs:string" /> <xs:attribute name="debug" type="xs:string" /> <xs:complexType name="SessionType"> <xs:attribute name="sID" use="required"> <xs:simpleType> <xs:restriction base="xs:string"/> </xs:simpleType> </xs:attribute> </xs:complexType> <xs:complexType name="ServiceRequestType"> <xs:sequence> <xs:element ref="session" /> </xs:sequence> <xs:attribute ref="method" /> <xs:attribute ref="debug" /> </xs:complexType> <xs:complexType name="OrderTrackingServiceRequest"> <xs:complexContent> <xs:extension base="ServiceRequestType"> <xs:complexType> <xs:sequence> <xs:element name="OrderInclusionCriteria" type="xs:string" /> </xs:sequence> </xs:complexType> </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="Action"> <xs:complexContent> <xs:extension base="ServiceRequestType"> <xs:complexType> <xs:sequence> <xs:element name="makePayment"> <xs:complexType> <xs:attribute name="accountID" type="xs:string" /> <xs:attribute name="amount" type="xs:string" /> <xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="aType" type="xs:string" /> </xs:complexType> </xs:extension> </xs:complexContent> </xs:complexType> </xs:schema>

    Read the article

  • Select Multiple Images Using GalleryView

    - by hwrdprkns
    Hi guys, I was just wondering if Android had built in code so that I could select multiple images in a gallery-view and then have those images exported as filenames in a string array(ex /sdcard/~f1.jpg, /sdcard/~f2.jpg,...). I have the gallery code here, but I'm not sure what modifications need to be made. Any help is appreciated. Thanks! // take_picture = (Button)findViewById(R.id.take_picture); // Here we set up a string array of the thumbnail ID column we want to // get back String[] proj = { MediaStore.Images.Thumbnails._ID }; if(proj.length == 0) { nopic.setVisibility(View.VISIBLE); } // Now we create the cursor pointing to the external thumbnail store cursor = managedQuery( MediaStore.Images.Thumbnails.EXTERNAL_CONTENT_URI, proj, // Which // columns // to // return null, // WHERE clause; which rows to return (all rows) null, // WHERE clause selection arguments (none) null); // Order-by clause (ascending by name) /* take_picture.setOnClickListener(new View.OnClickListener() { public void onClick(View v) { Intent i = new Intent(GalleryActivity.this, CameraActivity.class); startActivity(i); } }); */ // We now get the column index of the thumbnail id column_index = cursor .getColumnIndexOrThrow(MediaStore.Images.Thumbnails._ID); // Reference the Gallery view g = (Gallery) findViewById(R.id.gallery); if(proj.length == 0) { nopic.setVisibility(View.VISIBLE); g.setVisibility(View.GONE); } // Set the adapter to our custom adapter (below) g.setAdapter(new ImageAdapter(this)); // Set a item click listener, and just Toast the clicked position g.setOnItemClickListener(new OnItemClickListener() { public void onItemClick(AdapterView parent, View v, int position, long id) { // Now we want to actually get the data location of the file String[] proj = { MediaStore.Images.Media.DATA }; // We request our cursor again cursor = managedQuery( MediaStore.Images.Media.EXTERNAL_CONTENT_URI, proj, // Which // columns // to // return null, // WHERE clause; which rows to return (all rows) null, // WHERE clause selection arguments (none) null); // Order-by clause (ascending by name) // We want to get the column index for the data uri column_index = cursor .getColumnIndexOrThrow(MediaStore.Images.Media.DATA); // Lets move to the selected item in the cursor cursor.moveToPosition((int) g.getSelectedItemId()); // And here we get the filename String filename = cursor.getString(column_index); Log.v("GalleryActivity", filename); Toast.makeText(GalleryActivity.this, filename, Toast.LENGTH_SHORT).show(); setPrefs(filename); Intent i = new Intent(GalleryActivity.this, OtherClass.class); startActivity(i); } }); } And the ImageAdapter code here: public class ImageAdapter extends BaseAdapter { int mGalleryItemBackground; public ImageAdapter(Context c) { mContext = c; // See res/values/attrs.xml for the that defines // Gallery1. TypedArray a = obtainStyledAttributes(R.styleable.Gallery); mGalleryItemBackground = a.getResourceId( R.styleable.Gallery_android_galleryItemBackground, 0); a.recycle(); } public int getCount() { return cursor.getCount(); } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { ImageView i = new ImageView(mContext); if (convertView == null) { cursor.moveToPosition(position); int id = cursor.getInt(column_index); i.setImageURI(Uri.withAppendedPath( MediaStore.Images.Thumbnails.EXTERNAL_CONTENT_URI, "" + id)); i.setScaleType(ImageView.ScaleType.FIT_XY); i.setLayoutParams(new Gallery.LayoutParams(200, 200)); // The preferred Gallery item background i.setBackgroundResource(mGalleryItemBackground); } return i; } } Again any help is appreciateds! Just to let you guys know, the gallery works fine (for one image) as in it exports the filename correctly. Just need to know if there is an easy way to select multiples and export them. Thanks again!

    Read the article

  • Reuse a facelet in multiple beans

    - by Seitaridis
    How do I invoke/access a property of a managed bean when the bean name is known, but is not yet constructed? For example: <p:selectOneMenu value="#{eval.evaluateAsBean(bean).text}" > <f:selectItems value="#{eval.evaluateAsBean(bean).values}" var="val" itemLabel="#{val}" itemValue="#{val}" /> </p:selectOneMenu> If there is a managed bean called testBean and in my view bean has the "testBean"value, I want the text or values property of testBean to be called. EDIT1 The context An object consists of a list of properties(values). One property is modified with a custom JSF editor, depending on its type. The list of editors is determined from the object's type, and displayed in a form using custom:include tags. This custom tag is used to dynamically include the editors <custom:include src="#{editor.component}">. The component property points to the location of the JSF editor. In my example some editors(rendered as select boxes) will use the same facelet(dynamicDropdown.xhtml). Every editor has a session scoped managed bean. I want to reuse the same facelet with multiple beans and to pass the name of the bean to dynamicDropdown.xhtml using the bean param. genericAccount.xhtml <p:dataTable value="#{group.editors}" var="editor"> <p:column headerText="Key"> <h:outputText value="#{editor.name}" /> </p:column> <p:column headerText="Value"> <h:panelGroup rendered="#{not editor.href}"> <h:outputText value="#{editor.component}" escape="false" /> </h:panelGroup> <h:panelGroup rendered="#{editor.href}"> <custom:include src="#{editor.component}"> <ui:param name="enabled" value="#{editor.enabled}"/> <ui:param name="bean" value="#{editor.bean}"/> <custom:include> </h:panelGroup> </p:column> </p:dataTable> #{editor.component} refers to a dynamicDropdown.xhtml file. dynamicDropdown.xhtml <ui:composition xmlns="http://www.w3.org/1999/xhtml" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:p="http://primefaces.prime.com.tr/ui"> <p:selectOneMenu value="#{eval.evaluateAsBean(bean).text}" > <f:selectItems value="#{eval.evaluateAsBean(bean).values}" var="val" itemLabel="#{val}" itemValue="#{val}" /> </p:selectOneMenu> </ui:composition> eval is a managed bean: @ManagedBean(name = "eval") @ApplicationScoped public class ELEvaluator { ... public Object evaluateAsBean(String el) { FacesContext context = FacesContext.getCurrentInstance(); Object bean = context.getELContext() .getELResolver().getValue(context.getELContext(), null, el); return bean; } ... }

    Read the article

  • SQL Server 2008: Using Multiple dts Ranges to Build a Set of Dates

    - by raoulcousins
    I'm trying to build a query for a medical database that counts the number of patients that were on at least one medication from a class of medications (the medications listed below in the FAST_MEDS CTE) and had either: 1) A diagnosis of myopathy (the list of diagnoses in the FAST_DX CTE) 2) A CPK lab value above 1000 (the lab value in the FAST_LABS CTE) and this diagnosis or lab happened AFTER a patient was on a statin. The query I've included below does that under the assumption that once a patient is on a statin, they're on a statin forever. The first CTE collects the ids of patients that were on a statin along with the first date of their diagnosis, the second those with a diagnosis, and the third those with a high lab value. After this I count those that match the above criteria. What I would like to do is drop the assumption that once a patient is on a statin, they're on it for life. The table edw_dm.patient_medications has a column called start_dts and end_dts. This table has one row for each prescription written, with start_dts and end_dts denoting the start and end date of the prescription. End_dts could be null, which I'll take to assume that the patient is currently on this medication (it could be a missing record, but I can't do anything about this). If a patient is on two different statins, the start and ends dates can overlap, and there may be multiple records of the same medication for a patient, as in a record showing 3-11-2000 to 4-5-2003 and another for the same patient showing 5-6-2007 to 7-8-2009. I would like to use these two columns to build a query where I'm only counting the patients that had a lab value or diagnosis done during a time when they were already on a statin, or in the first n (say 3) months after they stopped taking a statin. I'm really not sure how to go about rewriting the first CTE to get this information and how to do the comparison after the CTEs are built. I know this is a vague question, but I'm really stumped. Any ideas? As always, thank you in advance. Here's the current query: WITH FAST_MEDS AS ( select distinct statins.mrd_pt_id, min(year(statins.order_dts)) as statin_yr from edw_dm.patient_medications as statins inner join mrd.medications as mrd on statins.mrd_med_id = mrd.mrd_med_id WHERE mrd.generic_nm in ( 'Lovastatin (9664708500)', 'lovastatin-niacin', 'Lovastatin/Niacin', 'Lovastatin', 'Simvastatin (9678583966)', 'ezetimibe-simvastatin', 'niacin-simvastatin', 'ezetimibe/Simvastatin', 'Niacin/Simvastatin', 'Simvastatin', 'Aspirin Buffered-Pravastatin', 'aspirin-pravastatin', 'Aspirin/Pravastatin', 'Pravastatin', 'amlodipine-atorvastatin', 'Amlodipine/atorvastatin', 'atorvastatin', 'fluvastatin', 'rosuvastatin' ) and YEAR(statins.order_dts) IS NOT NULL and statins.mrd_pt_id IS NOT NULL group by statins.mrd_pt_id ) select * into #meds from FAST_MEDS ; --return patients who had a diagnosis in the list and the year that --diagnosis was given with FAST_DX AS ( SELECT pd.mrd_pt_id, YEAR(pd.init_noted_dts) as init_yr FROM edw_dm.patient_diagnoses as pd inner join mrd.diagnoses as mrd on pd.mrd_dx_id = mrd.mrd_dx_id and mrd.icd9_cd in ('728.89','729.1','710.4','728.3','729.0','728.81','781.0','791.3') ) select * into #dx from FAST_DX; --return patients who had a high cpk value along with the year the cpk --value was taken with FAST_LABS AS ( SELECT pl.mrd_pt_id, YEAR(pl.order_dts) as lab_yr FROM edw_dm.patient_labs as pl inner join mrd.labs as mrd on pl.mrd_lab_id = mrd.mrd_lab_id and mrd.lab_nm = 'CK (CPK)' WHERE pl.lab_val between 1000 AND 999998 ) select * into #labs from FAST_LABS; -- count the number of patients who had a lab value or a medication -- value taken sometime AFTER their initial statin diagnosis select count(distinct p.mrd_pt_id) as ct from mrd.patient_demographics as p join #meds as m on p.mrd_pt_id = m.mrd_pt_id AND ( EXISTS ( SELECT 'A' FROM #labs l WHERE p.mrd_pt_id = l.mrd_pt_id and l.lab_yr >= m.statin_yr ) OR EXISTS( SELECT 'A' FROM #dx d WHERE p.mrd_pt_id = d.mrd_pt_id AND d.init_yr >= m.statin_yr ) )

    Read the article

  • Difference between SQL 2005 and SQL 2008 for inserting multiple rows with XML

    - by Sam Dahan
    I am using the following SQL code for inserting multiple rows of data in a table. The data is passed to the stored procedure using an XML variable : INSERT INTO MyTable SELECT SampleTime = T.Item.value('SampleTime[1]', 'datetime'), Volume1 = T.Item.value('Volume1[1]', 'float'), Volume2 = T.Item.value('Volume2[1]', 'float') FROM @xml.nodes('//Root/MyRecord') T(item) I have a whole bunch of unit tests to verify that I am inserting the right information, the right number of records, etc.. when I call the stored procedure. All fine and dandy - that is, until we began to monkey around with the compatibility level of the database. The code above worked beautifully as long as we kept the compatibility level of the DB at 90 (SQL 2005). When we set the compatibility level at 100 (SQL 2008), the unit tests failed, because the stored procedure using the code above times out. The unit tests are dropping the database, re-creating it from scripts, and running the tests on the brand new DB, so it's not - I think - a question of the 'old compatibility level' sticking around. Using the SQL Management studio, I made up a quick test SQL script. Using the same XML chunk, I alter the DB compat level , truncate the table, then use the code above to insert 650 rows. When the level is 90 (SQL 2005), it runs in milliseconds. When the level is 100 (SQL 2008) it sometimes takes over a minute, sometimes runs in milliseconds. I'd appreciate any insight anyone might have into that. EDIT The script takes over a minute to run with my actual data, which has more rows than I show here, is a real table, and has an index. With the following example code, the difference goes between milliseconds and around 5 seconds. --use [master] --ALTER DATABASE MyDB SET compatibility_level =100 use [MyDB] declare @xml xml set @xml = '<?xml version="1.0"?> <Root xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Record> <SampleTime>2009-01-24T00:00:00</SampleTime> <Volume1>0</Volume1> <Volume2>0</Volume2> </Record> ..... 653 records, sample time spaced out 4 hours ........ </Root>' DECLARE @myTable TABLE( ID int IDENTITY(1,1) NOT NULL, [SampleTime] [datetime] NOT NULL, [Volume1] [float] NULL, [Volume2] [float] NULL) INSERT INTO @myTable select T.Item.value('SampleTime[1]', 'datetime') as SampleTime, Volume1 = T.Item.value('Volume1[1]', 'float'), Volume2 = T.Item.value('Volume2[1]', 'float') FROM @xml.nodes('//Root/Record') T(item) I uncomment the 2 lines at the top, select them and run just that (the ALTER DATABASE statement), then comment the 2 lines, deselect any text and run the whole thing. When I change from 90 to 100, it runs all the time in 5 seconds (I change the level once, but I run the series several times to see if I have consistent results). When I change from 100 to 90, it runs in milliseconds all the time. Just so you can play with it too. I am using SQL Server 2008 R2 standard edition.

    Read the article

  • using getScript to import plugin on page using multiple versions of jQuery

    - by mikez302
    I am developing an app on a page that uses jQuery 1.2.6, but I would like to use jQuery 1.4.2 for my app. I really don't like to use multiple versions of jQuery like this but the copy on the page (1.2.6) is something I have no control over. I decided to isolate my code like this: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html><head> <script type="text/javascript" src="jquery-1.2.6.min.js> <script type="text/javascript" src="pageStuff.js"> </head> <body> Welcome to our page. <div id="app"> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="myStuff.js"> </div> </body></html> The file myStuff.js has my own code that is supposed to use jQuery 1.4.2, and it looks like this: (function($) { //wrap everything in function to add ability to use $ var with noConflict var jQuery = $; //my code })(jQuery.noConflict(true)); This is an extremely simplified version, but I hope you get the idea of what I did. For a while, everything worked fine. However, I decided to want to use a jQuery plugin in a separate file. I tested it and it acted funny. After some experimentation, I found out that the plugin was using the old version of jQuery, when I wanted it to use the new version. Does anyone know how to import and run a js file from the context within the function wrapping the code in myStuff.js? In case this matters to anyone, here is how I know the plugin is using the old version, and what I did to try to solve the problem: I made a file called test.js, consisting of this line: alert($.fn.jquery); I tried referencing the file in a script tag the way external Javascript is usually included, below myStuff.js, and it came up as 1.2.6, like I expected. I then got rid of that script tag and put this line in myStuff.js: $.getScript("test.js"); and it still came back as 1.2.6. That wasn't a big surprise -- according to jQuery's documentation, scripts included that way are executed in the global context. I then tried doing this instead: var testFn = $.proxy($.getScript, this); testFn("test.js"); and it still came back as 1.2.6. After some tinkering, I found out that the "this" keyword referred to the window, which I assume means the global context. I am looking for something to put in place of "this" to refer to the context of the enclosing function, or some other way to make the code in the file run from the enclosing function. I noticed that if I copy and paste the code, it works fine, but it is a big plugin that is used in many places, and I would prefer not to clutter up my file with their code. I am out of ideas. Does anyone else know how to do this?

    Read the article

  • Multiple data series in real time plot

    - by Gr3n
    Hi, I'm kind of new to Python and trying to create a plotting app for values read via RS232 from a sensor. I've managed (after some reading and copying examples online) to get a plot working that updates on a timer which is great. My only trouble is that I can't manage to get multiple data series into the same plot. Does anyone have a solution to this? This is the code that I've worked out this far: import os import pprint import random import sys import wx # The recommended way to use wx with mpl is with the WXAgg backend import matplotlib matplotlib.use('WXAgg') from matplotlib.figure import Figure from matplotlib.backends.backend_wxagg import FigureCanvasWxAgg as FigCanvas, NavigationToolbar2WxAgg as NavigationToolbar import numpy as np import pylab DATA_LENGTH = 100 REDRAW_TIMER_MS = 20 def getData(): return int(random.uniform(1000, 1020)) class GraphFrame(wx.Frame): # the main frame of the application def __init__(self): wx.Frame.__init__(self, None, -1, "Usart plotter", size=(800,600)) self.Centre() self.data = [] self.paused = False self.create_menu() self.create_status_bar() self.create_main_panel() self.redraw_timer = wx.Timer(self) self.Bind(wx.EVT_TIMER, self.on_redraw_timer, self.redraw_timer) self.redraw_timer.Start(REDRAW_TIMER_MS) def create_menu(self): self.menubar = wx.MenuBar() menu_file = wx.Menu() m_expt = menu_file.Append(-1, "&Save plot\tCtrl-S", "Save plot to file") self.Bind(wx.EVT_MENU, self.on_save_plot, m_expt) menu_file.AppendSeparator() m_exit = menu_file.Append(-1, "E&xit\tCtrl-X", "Exit") self.Bind(wx.EVT_MENU, self.on_exit, m_exit) self.menubar.Append(menu_file, "&File") self.SetMenuBar(self.menubar) def create_main_panel(self): self.panel = wx.Panel(self) self.init_plot() self.canvas = FigCanvas(self.panel, -1, self.fig) # pause button self.pause_button = wx.Button(self.panel, -1, "Pause") self.Bind(wx.EVT_BUTTON, self.on_pause_button, self.pause_button) self.Bind(wx.EVT_UPDATE_UI, self.on_update_pause_button, self.pause_button) self.hbox1 = wx.BoxSizer(wx.HORIZONTAL) self.hbox1.Add(self.pause_button, border=5, flag=wx.ALL | wx.ALIGN_CENTER_VERTICAL) self.vbox = wx.BoxSizer(wx.VERTICAL) self.vbox.Add(self.canvas, 1, flag=wx.LEFT | wx.TOP | wx.GROW) self.vbox.Add(self.hbox1, 0, flag=wx.ALIGN_LEFT | wx.TOP) self.panel.SetSizer(self.vbox) #self.vbox.Fit(self) def create_status_bar(self): self.statusbar = self.CreateStatusBar() def init_plot(self): self.dpi = 100 self.fig = Figure((3.0, 3.0), dpi=self.dpi) self.axes = self.fig.add_subplot(111) self.axes.set_axis_bgcolor('white') self.axes.set_title('Usart data', size=12) pylab.setp(self.axes.get_xticklabels(), fontsize=8) pylab.setp(self.axes.get_yticklabels(), fontsize=8) # plot the data as a line series, and save the reference # to the plotted line series # self.plot_data = self.axes.plot( self.data, linewidth=1, color="blue", )[0] def draw_plot(self): # redraws the plot xmax = len(self.data) if len(self.data) > DATA_LENGTH else DATA_LENGTH xmin = xmax - DATA_LENGTH ymin = 0 ymax = 4096 self.axes.set_xbound(lower=xmin, upper=xmax) self.axes.set_ybound(lower=ymin, upper=ymax) # enable grid #self.axes.grid(True, color='gray') # Using setp here is convenient, because get_xticklabels # returns a list over which one needs to explicitly # iterate, and setp already handles this. # pylab.setp(self.axes.get_xticklabels(), visible=True) self.plot_data.set_xdata(np.arange(len(self.data))) self.plot_data.set_ydata(np.array(self.data)) self.canvas.draw() def on_pause_button(self, event): self.paused = not self.paused def on_update_pause_button(self, event): label = "Resume" if self.paused else "Pause" self.pause_button.SetLabel(label) def on_save_plot(self, event): file_choices = "PNG (*.png)|*.png" dlg = wx.FileDialog( self, message="Save plot as...", defaultDir=os.getcwd(), defaultFile="plot.png", wildcard=file_choices, style=wx.SAVE) if dlg.ShowModal() == wx.ID_OK: path = dlg.GetPath() self.canvas.print_figure(path, dpi=self.dpi) self.flash_status_message("Saved to %s" % path) def on_redraw_timer(self, event): if not self.paused: newData = getData() self.data.append(newData) self.draw_plot() def on_exit(self, event): self.Destroy() def flash_status_message(self, msg, flash_len_ms=1500): self.statusbar.SetStatusText(msg) self.timeroff = wx.Timer(self) self.Bind( wx.EVT_TIMER, self.on_flash_status_off, self.timeroff) self.timeroff.Start(flash_len_ms, oneShot=True) def on_flash_status_off(self, event): self.statusbar.SetStatusText('') if __name__ == '__main__': app = wx.PySimpleApp() app.frame = GraphFrame() app.frame.Show() app.MainLoop()

    Read the article

  • opengl - Rendering multiple cubes

    - by opiop65
    I have this code (Doesn't work at all) static void initGl() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glMatrixMode(GL_PROJECTION); glLoadIdentity(); GLU.gluPerspective(45.0f, Display.getWidth() / Display.getHeight(), 1.0f, 1000.0f); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glClearColor(0.0f, 0.0f, 0.0f, 0.0f); glClearDepth(1.0f); glDepthFunc(GL_LEQUAL); glEnable(GL_DEPTH_TEST); glShadeModel(GL_SMOOTH); glHint(GL_PERSPECTIVE_CORRECTION_HINT, GL_NICEST); } public static void renderGL() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glClearColor(0.0f, 0.0f, 0.0f, 0.5f); glLoadIdentity(); glTranslatef(0.0f, 0.0f, -60.0f); drawCube(); } public static void drawCube() { for (int x = 0; x < 100; x++) { for (int y = 0; y < 100; y++) { for (int z = 0; z < 100; z++) { glBegin(GL_QUADS); glColor3f(1, 0, 0); glVertex3f(-x, -y, z); glVertex3f(x, -y, z); glVertex3f(x, y, z); glVertex3f(-x, y, z); glColor3f(1, 0, 1); glVertex3f(x, -y, -z); glVertex3f(-x, -y, -z); glVertex3f(-x, y, -z); glVertex3f(x, y, -z); glColor3f(1, 1, 1); glVertex3f(-x, y, z); glVertex3f(x, y, z); glVertex3f(x, y, -z); glVertex3f(-x, y, -z); glColor3f(0, 0, 1); glVertex3f(x, -y, z); glVertex3f(-x, -y, z); glVertex3f(-x, -y, -z); glVertex3f(x, -y, -z); glColor3f(1, 1, 0); glVertex3f(x, -y, z); glVertex3f(x, -y, -z); glVertex3f(x, y, -z); glVertex3f(x, y, z); glColor3f(0, 2, 1); glVertex3f(-x, -y, -z); glVertex3f(-x, -y, z); glVertex3f(-x, y, z); glVertex3f(-x, y, -z); glEnd(); } } } All it does it freeze up the program and eventually it will render the red side of the cube. This obviously has to do with gltranslatef, but I don't know why that isn't working. My question is, how do I render multiple cubes at once? Are there any tutorials out there on voxel engines? Sorry for the horrible code, I realize I probably need a array to do this. I'm quite new at opengl.

    Read the article

  • Get Two row with multiple column in asp.net c#

    - by Gaurav Naik
    How to get data from database with two rows and multiple column with seperator will be there after the 1 row end as an example: <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box3"> <div class="_t1_box"><a href="#"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div> <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div>

    Read the article

  • multiple timer to one process (without linking to rt)

    - by Richard
    Hi, is there any way to register multiple timer to a single process? I have tried following code, yet without success. (Use "gcc -lrt" to compile it...). Program output nothing, which should atleast print "test". Is it possibly due to the dependence to linking to rt? #define TT_SIGUSR1 (SIGRTMAX) #define TT_SIGUSR2 (SIGRTMAX - 1) #define TIME_INTERVAL_1 1 #define TIME_INTERVAL_2 2 #include <signal.h> #include <time.h> #include <stdio.h> #include <unistd.h> #include <linux/unistd.h> #include <sys/syscall.h> #include <sys/time.h> #include <sys/types.h> #include <sched.h> #include <signal.h> #include <setjmp.h> #include <errno.h> #include <assert.h> timer_t create_timer(int signo) { timer_t timerid; struct sigevent se; se.sigev_signo = signo; if (timer_create(CLOCK_REALTIME, &se, &timerid) == -1) { fprintf(stderr, "Failed to create timer\n"); exit(-1); } return timerid; } void set_timer(timer_t timerid, int seconds) { struct itimerspec timervals; timervals.it_value.tv_sec = seconds; timervals.it_value.tv_nsec = 0; timervals.it_interval.tv_sec = seconds; timervals.it_interval.tv_nsec = 0; if (timer_settime(timerid, 0, &timervals, NULL) == -1) { fprintf(stderr, "Failed to start timer\n"); exit(-1); } return; } void install_sighandler2(int signo, void(*handler)(int)) { struct sigaction sigact; sigemptyset(&sigact.sa_mask); sigact.sa_flags = SA_SIGINFO; //register the Signal Handler sigact.sa_sigaction = handler; // Set up sigaction to catch signal first timer if (sigaction(signo, &sigact, NULL) == -1) { printf("sigaction failed"); return -1; } } void install_sighandler(int signo, void(*handler)(int)) { sigset_t set; struct sigaction act; /* Setup the handler */ act.sa_handler = handler; act.sa_flags = SA_RESTART; sigaction(signo, &act, 0); /* Unblock the signal */ sigemptyset(&set); sigaddset(&set, signo); sigprocmask(SIG_UNBLOCK, &set, NULL); return; } void signal_handler(int signo) { printf("receiving sig %d", signo); } int main() { printf("test"); timer_t timer1 = create_timer(TT_SIGUSR1); timer_t timer2 = create_timer(TT_SIGUSR2); set_timer(timer1, TIME_INTERVAL_1); set_timer(timer2, TIME_INTERVAL_2); install_sighandler2(TT_SIGUSR1, signal_handler); install_sighandler(TT_SIGUSR2, signal_handler); while (1) ; return 0; }

    Read the article

  • Hover/Fadeto/Toggle Multiple Class Changing

    - by Slick Willis
    So my problem is rather simple and complex at the same time. I am trying to create links that fade in when you mouseover them and fade out when you mouseout of them. At the same time that you are going over them I would like a pic to slide from the left. This is the easy part, I have every thing working. The image fades and another image slides. I did this by using a hover, fadeto, and toggle("slide"). I would like to do this in a table format with multiple images being able to be scrolled over and sliding images out. The problem is that I am calling my sliding image to a class and when I hover over the letters both images slide out. Does anybody have a solution for this? I posted the code that I used below: <html> <head> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-1.4.2.min.js'></script> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-custom-181/jquery-ui-1.8.1.custom.min.js'></script> <style type="text/css"> .text-slide { display: none; margin: 0px; width: 167px; height: 50px; } </style> <script> $(document).ready(function(){ $(".letterbox-fade").fadeTo(1,0.25); $(".letterbox-fade").hover(function () { $(this).stop().fadeTo(250,1); $(".text-slide").toggle("slide", {}, 1000); }, function() { $(this).stop().fadeTo(250,0.25); $(".text-slide").toggle("slide", {}, 1000); }); }); </script> </head> <body style="background-color: #181818"> <table> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/A-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/B-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> </table> </body> </html>

    Read the article

  • PHP-How to Pass Multiple Value In Form Field

    - by Tall boY
    hi i have a php based sorting method with drop down menu to sort no of rows, it is working fine. i have another sorting links to sort id & title, it is also working fine. but together they are not working fine. what happens is that when i sort(say by title) using links, result gets sorted by title, then if i sort rows using drop down menu rows get sorted but result gets back to default of id sort. sorting codes for id & tite is if ($orderby == 'title' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} if ($orderby == 'title' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} if ($orderby == 'id' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} if ($orderby == 'id' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} ?> sorting codes for rows is <form action="is-test.php" method="get"> <select name="rpp" onchange="this.form.submit()"> <option value="10" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this method passes only rows per page(rpp) into url. i want it to pass order, sort& rpp. is there a way around to pass multiple values in form fields like this. <form action="is-test.php" method="get"> <select name="rpp, order, sort" onchange="this.form.submit()"> <option value="10, $orderby, $sortby" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20, $orderby, $sortby" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30, $orderby, $sortby" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this may seem silly but it just to give you an idea of what i am trying to implement,(i am very new to php) please suggest any way to make this work. thanks

    Read the article

  • NoMethodError Rails multiple file uploads

    - by Danny McClelland
    Hi Everyone, I am working on getting multiple file uploads working for an model in my application, I have included the code below: delivers_controller.rb # POST /delivers def create @deliver = Deliver.new(params[:deliver]) process_file_uploads(@deliver) if @deliver.save flash[:notice] = 'Task was successfully created.' redirect_to(@deliver) else render :action => "new" end end protected def process_file_uploads(deliver) i = 0 while params[:attachment]['file_'+i.to_s] != "" && !params[:attachment]['file_'+i.to_s].nil? deliver.assets.build(:data => params[:attachment]['file_'+i.to_s]) i += 1 end end deliver.rb has_many :assets, :as => :attachable, :dependent => :destroy validate :validate_attachments Max_Attachments = 5 Max_Attachment_Size = 5.megabyte def validate_attachments errors.add_to_base("Too many attachments - maximum is #{Max_Attachments}") if assets.length > Max_Attachments assets.each {|a| errors.add_to_base("#{a.name} is over #{Max_Attachment_Size/1.megabyte}MB") if a.file_size > Max_Attachment_Size} end assets_controller.rb class AssetsController < ApplicationController def show asset = Asset.find(params[:id]) # do security check here send_file asset.data.path, :type => asset.data_content_type end def destroy asset = Asset.find(params[:id]) @asset_id = asset.id.to_s @allowed = Deliver::Max_Attachments - asset.attachable.assets.count asset.destroy end end asset.rb class Asset < ActiveRecord::Base has_attached_file :data, belongs_to :attachable, :polymorphic => true def url(*args) data.url(*args) end def name data_file_name end def content_type data_content_type end def file_size data_file_size end end Whenever I create a new deliver item and try to attach any files I get the following error: NoMethodError in DeliversController#create You have a nil object when you didn't expect it! You might have expected an instance of ActiveRecord::Base. The error occurred while evaluating nil.[] /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:60:in `process_file_uploads' /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:46:in `create' new.html.erb (Deliver view) <% content_for :header do -%> Deliver Repositories <% end -%> <% form_for(@deliver, :html => { :multipart => true }) do |f| %> <%= f.error_messages %> <p> <%= f.label :caseref %><br /> <%= f.text_field :caseref %> </p> <p> <%= f.label :casesubject %><br /> <%= f.text_area :casesubject %> </p> <p> <%= f.label :description %><br /> <%= f.text_area :description %> </p> <p>Pending Attachments: (Max of <%= Deliver::Max_Attachments %> each under <%= Deliver::Max_Attachment_Size/1.megabyte%>MB) <% if @deliver.assets.count >= Deliver::Max_Attachments %> <input id="newfile_data" type="file" disabled /> <% else %> <input id="newfile_data" type="file" /> <% end %> <div id="attachment_list"><ul id="pending_files"></ul></div> </p> <p> <%= f.submit 'Create' %> </p> <% end %> <%= link_to 'Back', delivers_path %> Show.html.erb (Delivers view) <% content_for :header do -%> Deliver Repositories <% end -%> <p> <b>Title:</b> <%=h @deliver.caseref %> </p> <p> <b>Body:</b> <%=h @deliver.casesubject %> </p> <p><b>Attached Files:</b><div id="attachment_list"><%= render :partial => "attachment", :collection => @deliver.assets %></div></p> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', deliver_path %> <%- if logged_in? %> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', delivers_path %> <% end %> _attachment.html.erb (Delivers view) <% if !attachment.id.nil? %><li id='attachment_<%=attachment.id %>'><a href='<%=attachment.url %>'><%=attachment.name %></a> (<%=attachment.file_size/1.kilobyte %>KB) <%= link_to_remote "Remove", :url => asset_path(:id => attachment), :method => :delete, :html => { :title => "Remove this attachment", :id => "remove" } %></li> <% end %> I have been banging my head against the wall with the error all day, if anyone can shed some light on it, I would be eternally grateful! Thanks, Danny

    Read the article

  • How to publish multiple jar files to maven on a clean install

    - by Abhijit Hukkeri
    I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Android Multiple objects in SimpleAdapter

    - by Adam Sherratt
    I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

    Read the article

  • How can I use curl to login multiple users from one php script

    - by kamal
    Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

    Read the article

  • Send mail to multiple recipient

    - by Ahmad Maslan
    Hi, i have already research on using the mail() to send to multiple recipient's but i just cant get it to work. What im trying to do is, for every order that i have, order 1,2,3, each having their own email addresses, when i change their order status from pending to confirm, the mail() will use that id to refer to the db table and send the email of those 3 orders. But for my case, it mailed just the latest order which is order 3. This is the form that i use to change the order status. <form action="results-action" method="post" enctype="multipart/form-data"> <fieldset> <table id ="table_id" class="display"> <thead> <tr><td><h2>Pending Order</h2></td></tr> <tr> <th scope="col">Order ID</th> <th scope="col"> </th> <th scope="col">Name</th> <th scope="col">Address</th> <th scope="col">Product Name</th> <th scope="col">Produt Quantity</th> <th scope="col">Price</th> <th scope="col">Order status</th> </tr> </thead> <tbody> <?php while ($row = mysqli_fetch_array($result)) { ?> <tr> <td><input type="text" value='<?=$row['virtuemart_order_id']?>' name="orderid" id="virtuemart_order_id"></td> <td><input type="hidden" value='<?=$row['virtuemart_product_id']?>' name="productid" id="virtuemart_product_id"></td> <td><?=$row['first_name']?></td> <td><?=$row['address_1']?></td> <td><?=$row['order_item_name']?></td> <td><?=$row['product_quantity']?></td> <td><?=$row['product_final_price'] ?></td> <td><select name='change[<?=$row['virtuemart_order_id']?>]'> <option value='C'> Confirmed</option> <option value='X'> Cancelled</option></select></td> </tr> <?php } ?> </tbody> </table> </fieldset> <fieldset> <table> <tr> <td><input type="submit" value="Update status" name="update status"> </td> </tr> </table> </fieldset> </form> This is the php, using the order id from the form to select the email addresses. <?php $orderid = $_POST['orderid']; // build SQL statement to select email addresses $query3 = "SELECT email from ruj3d_virtuemart_order_userinfos where virtuemart_order_id = '$orderid'"; // execute SQL statement $result3 = mysqli_query($link, $query3) or die(mysqli_error($link)); $subject = "Order confirmed by Home and decor"; $message = "Hello! This is a message to inform that your order has been confirmed"; $from = "[email protected]"; $headers = "From: $from"; while($row3 = mysqli_fetch_array($result3)){ $addresses[] = $row3['email']; } $to = implode(",", $addresses); mail($to, $subject, $message, $headers); ?>

    Read the article

  • Changing multiple objects with a new class name using Jquery

    - by liquilife
    I'd like to click on a trigger and show a specific image. There are multiple triggers which would show a specific image related to it within a set. There are 4 sets The challenge for me is toggling the other images to hide only in this 'set' when one of these triggers are clicked, as there can only be one image showing at a time in each set. Here is the HTML I've put together thus far: <!-- Thumbnails which can be clicked on to toggle the larger preview image --> <div class="materials"> <a href="javascript:;" id="shirtgrey"><img src="/grey_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtred"><img src="red_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtblue"><img src="hblue_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtgreen"><img src="green_shirt.png" height="122" width="122" /></a> </div> <div class="collars"> <a href="javascript:;" id="collargrey"><img src="grey_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarred"><img src="red_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarblue"><img src="blue_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collargreen"><img src="green_collar.png" height="122" width="122" /></a> </div> <div class="cuffs"> <a href="javascript:;" id="cuffgrey"><img src="grey_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffred"><img src="red_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffblue"><img src="blue_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffgreen"><img src="/green_cuff.png" height="122" width="122" /></a> </div> <div class="pockets"> <a href="javascript:;" id="pocketgrey"><img src="grey_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketred"><img src=".png" height="122" width="122" /></a> <a href="javascript:;" id="pocketblue"><img src="blue_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketgreen"><img src="green_pocket.png" height="122" width="122" /></a> </div> <!-- The larger images where one from each set should be viewable at one time, triggered by the thumb clicked above --> <div class="selectionimg"> <div class="selectShirt"> <img src="grey_shirt.png" height="250" width="250" class="selectShirtGrey show" /> <img src="red_shirt.png" height="250" width="250" class="selectShirtRed hide" /> <img src="blue_shirt.png" height="250" width="250" class="selectShirtBlue hide" /> <img src="green_shirt.png" height="250" width="250" class="selectShirtGreen hide" /> </div> <div class="selectCollar"> <img src="grey_collar.png" height="250" width="250" class="selectCollarGrey show" /> <img src="red_collar.png" height="250" width="250" class="selectCollarRed hide" /> <img src="blue_collar.png" height="250" width="250" class="selectCollarBlue hide" /> <img src="green_collar.png" height="250" width="250" class="selectCollarGreen hide" /> </div> <div class="selectCuff"> <img src="grey_cuff.png" height="250" width="250" class="selectCuffGrey show" /> <img src="red_cuff.png" height="250" width="250" class="selectCuffRed hide" /> <img src="blue_cuff.png" height="250" width="250" class="selectCuffBlue hide" /> <img src="green_cuff.png" height="250" width="250" class="selectCuffGreen hide" /> </div> <div class="selectPocket"> <img src="grey_pocket.png" height="250" width="250" class="selectPocketGrey show" /> <img src="hred_pocket.png" height="250" width="250" class="selectPocketRed hide" /> <img src="blue_pocket.png" height="250" width="250" class="selectPocketBlue hide" /> <img src="green_pocket.png" height="250" width="250" class="selectPocketGreen hide" /> </div> </div> How can jQuery be used to change a class of an image to "show" and ensure that all other images in that same div are set to a class of "hide"? First time posting here. I'm very efficient with HTML and CSS and have a basic understanding of jQuery. I'm learning and this just seems a little bit beyond my abilities at the moment. I hope this all makes sense. Thanks for any help.

    Read the article

  • Error "Input length must be multiple of 8 when decrypting with padded cipher"

    - by Ross Peoples
    I am trying to move a project from C# to Java for a learning exercise. I am still very new to Java, but I have a TripleDES class in C# that encrypts strings and returns a string value of the encrypted byte array. Here is my C# code: using System; using System.IO; using System.Collections.Generic; using System.Security.Cryptography; using System.Text; namespace tDocc.Classes { /// <summary> /// Triple DES encryption class /// </summary> public static class TripleDES { private static byte[] key = { 110, 32, 73, 24, 125, 66, 75, 18, 79, 150, 211, 122, 213, 14, 156, 136, 171, 218, 119, 240, 81, 142, 23, 4 }; private static byte[] iv = { 25, 117, 68, 23, 99, 78, 231, 219 }; /// <summary> /// Encrypt a string to an encrypted byte array /// </summary> /// <param name="plainText">Text to encrypt</param> /// <returns>Encrypted byte array</returns> public static byte[] Encrypt(string plainText) { UTF8Encoding utf8encoder = new UTF8Encoding(); byte[] inputInBytes = utf8encoder.GetBytes(plainText); TripleDESCryptoServiceProvider tdesProvider = new TripleDESCryptoServiceProvider(); ICryptoTransform cryptoTransform = tdesProvider.CreateEncryptor(key, iv); MemoryStream encryptedStream = new MemoryStream(); CryptoStream cryptStream = new CryptoStream(encryptedStream, cryptoTransform, CryptoStreamMode.Write); cryptStream.Write(inputInBytes, 0, inputInBytes.Length); cryptStream.FlushFinalBlock(); encryptedStream.Position = 0; byte[] result = new byte[encryptedStream.Length]; encryptedStream.Read(result, 0, (int)encryptedStream.Length); cryptStream.Close(); return result; } /// <summary> /// Decrypt a byte array to a string /// </summary> /// <param name="inputInBytes">Encrypted byte array</param> /// <returns>Decrypted string</returns> public static string Decrypt(byte[] inputInBytes) { UTF8Encoding utf8encoder = new UTF8Encoding(); TripleDESCryptoServiceProvider tdesProvider = new TripleDESCryptoServiceProvider(); ICryptoTransform cryptoTransform = tdesProvider.CreateDecryptor(key, iv); MemoryStream decryptedStream = new MemoryStream(); CryptoStream cryptStream = new CryptoStream(decryptedStream, cryptoTransform, CryptoStreamMode.Write); cryptStream.Write(inputInBytes, 0, inputInBytes.Length); cryptStream.FlushFinalBlock(); decryptedStream.Position = 0; byte[] result = new byte[decryptedStream.Length]; decryptedStream.Read(result, 0, (int)decryptedStream.Length); cryptStream.Close(); UTF8Encoding myutf = new UTF8Encoding(); return myutf.GetString(result); } /// <summary> /// Decrypt an encrypted string /// </summary> /// <param name="text">Encrypted text</param> /// <returns>Decrypted string</returns> public static string DecryptText(string text) { if (text == "") { return text; } return Decrypt(Convert.FromBase64String(text)); } /// <summary> /// Encrypt a string /// </summary> /// <param name="text">Unencrypted text</param> /// <returns>Encrypted string</returns> public static string EncryptText(string text) { if (text == "") { return text; } return Convert.ToBase64String(Encrypt(text)); } } /// <summary> /// Random number generator /// </summary> public static class RandomGenerator { /// <summary> /// Generate random number /// </summary> /// <param name="length">Number of randomizations</param> /// <returns>Random number</returns> public static int GenerateNumber(int length) { byte[] randomSeq = new byte[length]; new RNGCryptoServiceProvider().GetBytes(randomSeq); int code = Environment.TickCount; foreach (byte b in randomSeq) { code += (int)b; } return code; } } /// <summary> /// Hash generator class /// </summary> public static class Hasher { /// <summary> /// Hash type /// </summary> public enum eHashType { /// <summary> /// MD5 hash. Quick but collisions are more likely. This should not be used for anything important /// </summary> MD5 = 0, /// <summary> /// SHA1 hash. Quick and secure. This is a popular method for hashing passwords /// </summary> SHA1 = 1, /// <summary> /// SHA256 hash. Slower than SHA1, but more secure. Used for encryption keys /// </summary> SHA256 = 2, /// <summary> /// SHA348 hash. Even slower than SHA256, but offers more security /// </summary> SHA348 = 3, /// <summary> /// SHA512 hash. Slowest but most secure. Probably overkill for most applications /// </summary> SHA512 = 4, /// <summary> /// Derrived from MD5, but only returns 12 digits /// </summary> Digit12 = 5 } /// <summary> /// Hashes text using a specific hashing method /// </summary> /// <param name="text">Input text</param> /// <param name="hash">Hash method</param> /// <returns>Hashed text</returns> public static string GetHash(string text, eHashType hash) { if (text == "") { return text; } if (hash == eHashType.MD5) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA1) { SHA1Managed hasher = new SHA1Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA256) { SHA256Managed hasher = new SHA256Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA348) { SHA384Managed hasher = new SHA384Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA512) { SHA512Managed hasher = new SHA512Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.Digit12) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); string newHash = ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); return newHash.Substring(0, 12); } return ""; } /// <summary> /// Generates a hash based on a file's contents. Used for detecting changes to a file and testing for duplicate files /// </summary> /// <param name="info">FileInfo object for the file to be hashed</param> /// <param name="hash">Hash method</param> /// <returns>Hash string representing the contents of the file</returns> public static string GetHash(FileInfo info, eHashType hash) { FileStream hashStream = new FileStream(info.FullName, FileMode.Open, FileAccess.Read); string hashString = ""; if (hash == eHashType.MD5) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA1) { SHA1Managed hasher = new SHA1Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA256) { SHA256Managed hasher = new SHA256Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA348) { SHA384Managed hasher = new SHA384Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA512) { SHA512Managed hasher = new SHA512Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } hashStream.Close(); hashStream.Dispose(); hashStream = null; return hashString; } /// <summary> /// Converts a byte array to a hex string /// </summary> /// <param name="data">Byte array</param> /// <returns>Hex string</returns> public static string ByteToHex(byte[] data) { StringBuilder builder = new StringBuilder(); foreach (byte hashByte in data) { builder.Append(string.Format("{0:X1}", hashByte)); } return builder.ToString(); } /// <summary> /// Converts a hex string to a byte array /// </summary> /// <param name="hexString">Hex string</param> /// <returns>Byte array</returns> public static byte[] HexToByte(string hexString) { byte[] returnBytes = new byte[hexString.Length / 2]; for (int i = 0; i <= returnBytes.Length - 1; i++) { returnBytes[i] = byte.Parse(hexString.Substring(i * 2, 2), System.Globalization.NumberStyles.HexNumber); } return returnBytes; } } } And her is what I've got for Java code so far, but I'm getting the error "Input length must be multiple of 8 when decrypting with padded cipher" when I run the test on this: import java.security.InvalidAlgorithmParameterException; import java.security.InvalidKeyException; import javax.crypto.Cipher; import javax.crypto.NoSuchPaddingException; import javax.crypto.SecretKey; import javax.crypto.spec.IvParameterSpec; import javax.crypto.spec.SecretKeySpec; import com.tdocc.utils.Base64; public class TripleDES { private static byte[] keyBytes = { 110, 32, 73, 24, 125, 66, 75, 18, 79, (byte)150, (byte)211, 122, (byte)213, 14, (byte)156, (byte)136, (byte)171, (byte)218, 119, (byte)240, 81, (byte)142, 23, 4 }; private static byte[] ivBytes = { 25, 117, 68, 23, 99, 78, (byte)231, (byte)219 }; public static String encryptText(String plainText) { try { if (plainText.isEmpty()) return plainText; return Base64.decode(TripleDES.encrypt(plainText)).toString(); } catch (Exception e) { e.printStackTrace(); } return null; } public static byte[] encrypt(String plainText) throws InvalidKeyException, InvalidAlgorithmParameterException, NoSuchPaddingException { try { final SecretKey key = new SecretKeySpec(keyBytes, "DESede"); final IvParameterSpec iv = new IvParameterSpec(ivBytes); final Cipher cipher = Cipher.getInstance("DESede/CBC/PKCS5Padding"); cipher.init(Cipher.ENCRYPT_MODE, key, iv); final byte[] plainTextBytes = plainText.getBytes("utf-8"); final byte[] cipherText = cipher.doFinal(plainTextBytes); return cipherText; } catch (Exception e) { e.printStackTrace(); } return null; } public static String decryptText(String message) { try { if (message.isEmpty()) return message; else return TripleDES.decrypt(message.getBytes()); } catch (Exception e) { e.printStackTrace(); } return null; } public static String decrypt(byte[] message) { try { final SecretKey key = new SecretKeySpec(keyBytes, "DESede"); final IvParameterSpec iv = new IvParameterSpec(ivBytes); final Cipher cipher = Cipher.getInstance("DESede/CBC/PKCS5Padding"); cipher.init(Cipher.DECRYPT_MODE, key, iv); final byte[] plainText = cipher.doFinal(message); return plainText.toString(); } catch (Exception e) { e.printStackTrace(); } return null; } }

    Read the article

< Previous Page | 190 191 192 193 194 195 196 197 198 199 200 201  | Next Page >