Search Results

Search found 47 results on 2 pages for 'garg'.

Page 2/2 | < Previous Page | 1 2 

  • java.lang.ClassNotFoundException: com.mysql.jdbc.Driver

    - by Nitin Garg
    I am trying to connect to mysql database using java on windows7. Inspite of adding the complete url of jdbcdriver jar file in CLASSPATH, java.lang.ClassNotFoundException: com.mysql.jdbc.Driver is thrown. Could anyone tell me what i am missing here?? it works if i add the jar file in project library but i want to do it by CLASSPATH itself. My classpath looks like this- C:\jython2.5.1\javalib\mysql-connector-java-5.1.12-bin.jar

    Read the article

  • Unable to find sphinx.yml file

    - by Nikhil Garg
    I am running rails 2.2.3 with mysql as database scheme & thinking sphinx installed as plugin. I am having two problems : 1) I am unable to find file confing/sphinx.yml. I just have a config/development.sphinx.conf 2) I have specified min_infix_len & enable_start property from define_index method of model. I also have checked development.sphinx.conf file & these properties are correctly set there. But I am not getting any infix search results. Please help.

    Read the article

  • How to correctly load dependent JavaScript files

    - by Vaibhav Garg
    I am trying to extent a website page that displays google maps with the LabeledMarker. Google Maps API defines a class called GMarker which is extended by the LabeledMarker. The problem is, I cant seem to load the LabeledMarker script properly, i.e. after the Google API loads and I get the 'GMarker not defined' error. What is the correct way to specify the scripts in such cases? I am using ASP.NET's ClientScript.RegisterClientScriptInclude() first for the google API url and then immediately after with the LabeledMarker script file. The initial google API loader writes further script links that load the actual GMarker class. Shouldnt all those scripts be executed before the next script block(LabeledMarker script) is processed. I have checked the generated HTML and the script blocks are emitted in the right order. <script src="google api url" type="text/javascript"></script> ... (the above scripts uses document.write() etc to append further script blocks/sources) ... <script src="Scripts/LabeledMarker.js" type="text/javascript"></script> Once again, the LabeledMarker.js seems to get executed before the google API finishes loading.

    Read the article

  • How to restrict text search to a certain subset of the database ?

    - by Nikhil Garg
    I have a large central database of around 1 million heavy records. In my app, for every user I would have a subset of rows from central table, which would be very small (probably 100 records each).When a particular user has logged in , I would want to search on this data set only. Example: Say I have a central database of all cars in the world. I have a user profile for General Motors(GM) , Ferrari etc. When GM is logged in I just want to search(a full text search and not fire a sql query) for those cars which are manufactured by GM. Also GM may launch/withdraw a model in which case central db would be updated & so would be rowset associated with GM. In case of acquisitions, db of certain profiles may change without launch/removal of new car. So central db wont change then , but rowsets may. Whats the best way to implement such a design ? These smaller row sets would need to be dynamic depending on user activities. We are on Rails 2.3.5 and use thinking_sphinx as the connector and Sphinx/MySQL for search and relational associations.

    Read the article

  • Does control return after "execvp()"

    - by Ajay Garg
    "execvp()" replaces the current program with the to-be-execed program (of course in the same process context). So, putting, say, any printf() calls after execvp() won't work. That is what the docs say, and I have verified it as well. But then, why is _exit() needed..? Does it so happen that the control DOES return to statements post execvp() ? I will be grateful for any pointers. Thanks

    Read the article

  • Adding custom/new properties to any file regardless of type and extension e.g. setting 'Author' on a

    - by Vaibhav Garg
    I want the ability add properties and tags to a file (specifically ebook files and ebook related properties in Windows 7 but interested to go so for as many OSes as possible) For e.g. Example.txt or Example.doc or Example.epub should all store and carry properties like 'Author', 'Publication date', 'Tags' etc.. the properties should be stored with the file itself. Such that if it is transferred to another system it retains the properties (even if i need to install 'my app' to support this function on the other machine) How do I make this possible using .net (preferred) and what file system concepts should I learn to understand the underlying concepts and limitations to be able to implement this feature? Any application that already does this? Thank you

    Read the article

  • Posting data to a HttpHandler greater then ~29MB gives a 404 error

    - by Vaibhav Garg
    I am testing a HttpHandler that accepts XML. It works fine when a small amount of data is posted but if I post data larger then approx 29mb, I get a asp.net 404 Error. I am posting to the handler from another handler in the same project and I have tried 2 methods - 1. HttpWebRequest with "POST" 2. WebClient with UploadFile() and UploadData() I get the same 404 error when the posted data is above 29mb. I also tried putting a breakpoint right in the beginning of the receiving handler and debugging. It is never hit. Appears like the handler was never called. Works ok for smaller sized data. What am I doing Wrong? (Thanks in advance for helping)

    Read the article

  • java servlet:response.sendRedirect() not giving illegal state exception if called after commit of re

    - by sahil garg
    after commit of response as here redirect statement should give exception but it is not doing so if this redirect statemnet is in if block.but it does give exception in case it is out of if block.i have shown same statement(with marked stars ) at two places below.can u please tell me reason for it. protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { // TODO Auto-generated method stub synchronized (noOfRequests) { noOfRequests++; } PrintWriter pw=null; response.setContentType("text/html"); response.setHeader("foo","bar"); //response is commited because of above statement pw=response.getWriter(); pw.print("hello : "+noOfRequests); //if i remove below statement this same statement is present in if block.so statement in if block should also give exception as this one do, but its not doing so.why? ***response.sendRedirect("http://localhost:8625/ServletPrc/login% 20page.html"); if(true) { //same statement as above ***response.sendRedirect("http://localhost:8625/ServletPrc/login%20page.html"); } else{ request.setAttribute("noOfReq", noOfRequests); request.setAttribute("name", new Name().getName()); request.setAttribute("GmailId",this.getServletConfig().getInitParameter("GmailId") ); request.setAttribute("YahooId",this.getServletConfig().getInitParameter("YahooId") ); RequestDispatcher view1=request.getRequestDispatcher("HomePage.jsp"); view1.forward(request, response); } }

    Read the article

  • Validate a XDocument against schema without the ValidationEventHandler (for use in a HTTP handler)

    - by Vaibhav Garg
    Hi everyone, (I am new to Schema validation) Regarding the following method, System.Xml.Schema.Extensions.Validate( ByVal source As System.Xml.Linq.XDocument, ByVal schemas As System.Xml.Schema.XmlSchemaSet, ByVal validationEventHandler As System.Xml.Schema.ValidationEventHandler, ByVal addSchemaInfo As Boolean) I am using it as follows inside a IHttpHandler - Try Dim xsd As XmlReader = XmlReader.Create(context.Server.MapPath("~/App_Data/MySchema.xsd")) Dim schemas As New XmlSchemaSet() : schemas.Add("myNameSpace", xsd) : xsd.Close() myXDoxumentOdj.Validate(schemas, Function(s As Object, e As ValidationEventArgs) SchemaError(s, e, context), True) Catch ex1 As Threading.ThreadAbortException 'manage schema error' Return Catch ex As Exception 'manage other errors' End Try The handler- Function SchemaError(ByVal s As Object, ByVal e As ValidationEventArgs, ByVal c As HttpContext) As Object If c Is Nothing Then c = HttpContext.Current If c IsNot Nothing Then HttpContext.Current.Response.Write(e.Message) HttpContext.Current.Response.End() End If Return New Object() End Function This is working fine for me at present but looks very weak. I do get errors when I feed it bad XML. But i want to implement it in a more elegant way. This looks like it would break for large XML etc. Is there some way to validate without the handler so that I get the document validated in one go and then deal with errors? To me it looks Async such that the call to Validate() would pass and some non deterministic time later the handler would get called with the result/errors. Is that right? Thanks and sorry for any goofy mistakes :).

    Read the article

  • Saving user settings in Metro app using C#

    - by jitendra garg
    I want to write user selected settings in Metro app, in Local Folder. I have done the code as below, but it is not working. The code to save settings: void OnUnloaded(object sender, RoutedEventArgs args) { //code to save app settings. var localSettings = ApplicationData.Current.LocalSettings; localSettings.Values["playerPosition"] = playerPosition; localSettings.Values["aiPosition"] = aiPosition; localSettings.Values["selectedLevel"] = selectedLevel; } The code to read settings: var localSettings = ApplicationData.Current.LocalSettings; if ((localSettings.Values["playerPosition"]) == null) { localSettings.Values["playerPosition"] = 1; localSettings.Values["aiPosition"] = 1; localSettings.Values["selectedLevel"] = "1"; playerPosition = aiPosition = 1; selectedLevel = "1"; } else { playerPosition = (int)localSettings.Values["playerPosition"]; aiPosition = (int)localSettings.Values["aiPosition"]; selectedLevel = (string)localSettings.Values["selectedLevel"]; ---- Clearly I am supposed to save this localSettings variable in a file. But, I am unable to find the code to do that. Also, is Unload event a good place to do it, or should I move it to OnNavigatedFrom event?

    Read the article

  • how to create image thumbnails using django running on jython?

    - by Nitin Garg
    Hi guys, I am a newbee to django and jython. I need to create and save image thumbnails in database. I am using django running on jython and mysql database. I was exploring python imaging library, but the i found out that i wont work with jython. How do i create image thumbnails using jython and then save them in mysql db?? Any kind of help will be appreciated. thanx

    Read the article

  • summer training

    - by rohit-garg
    hi i wanna make a retail store software for my family retail store .... can anyone help me out with which language to use and just give me some basic ideas I'm an engineering student and have good knowledge of ASP, HTML, CSS, VBSCRIPT and have gone through java , c ,c++. please help me anyone

    Read the article

  • Merging some columns of two mysql tables where id = fileid

    - by garg
    There are two tables TableA filedata_id | user_id | filename 1 | 1 | file.txt 2 | 1 | file2.txt TableB a_id | date | filedataid | counter | state | cat_id | subcat_id | med_id 99 | 1242144 | 1 | 2 | v | 55 | 56 | 90 100 | 1231232 | 2 | 3 | i | 44 | 55 | 110 I want to move columns cat_id, subcat_id, med_id to TableA where tableA.filedata_id = TableB.filedataid The result should be: TableA filedata_id | user_id | filename | cat_id | subcat_id | med_id 1 | 1 | file.txt | 55 | 56 | 90 2 | 1 | file2.txt | 44 | 55 | 110 and so on. Is there a way to do this easily?

    Read the article

  • SQL SERVER – Winners – Contest Win Joes 2 Pros Combo (USD 198)

    - by pinaldave
    Earlier this week we had contest ran over the blog where we are giving away USD 198 worth books of Joes 2 Pros. We had over 500+ responses during the five days of the contest. After removing duplicate and incorrect responses we had a total of 416 valid responses combined total 5 days. We got maximum correct answer on day 2 and minimum correct answer on day 5. Well, enough of the statistics. Let us go over the winners’ names. The winners have been selected randomly by one of the book editors of Joes 2 Pros. SQL Server Joes 2 Pros Learning Kit 5 Books Day 1 Winner USA: Philip Dacosta India: Sandeep Mittal Day 2 Winner USA: Michael Evans India: Satyanarayana Raju Pakalapati Day 3 Winner USA: Ratna Pulapaka India: Sandip Pani Day 4 Winner USA: Ramlal Raghavan India: Dattatrey Sindol Day 5 Winner USA: David Hall India: Mohit Garg I congratulate all the winners for their participation. All of you will receive emails from us. You will have to reply the email with your physical address. Once you receive an email please reply within 3 days so we can ship the 5 book kits to you immediately. Bonus Winners Additionally, I had announced that every day I will select a winner from the readers who have left comments with their favorite blog post. Here are the winners with their favorite blog post. Day 1: Prasanna kumar.D [Favorite Post] Day 2: Ganesh narim [Favorite Post] Day 3: Sreelekha [Favorite Post] Day 4: P.Anish Shenoy [Favorite Post] Day 5: Rikhil [Favorite Post] All the bonus winners will receive my print book SQL Wait Stats if your shipping address is in India or Pluralsight Subscription if you are outside India. If you are not winner of the contest but still want to learn SQL Server you can get the book from here. Amazon | 1 | 2 | 3 | 4 | 5 | Flipkart | Indiaplaza Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Joes 2 Pros, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • OBJC_CLASS_$_MTSCRA", referenced from

    - by user1078841
    I was trying to make a sample code run download by the link http://www.magtek.com/support/software/downloads/sw/99510108.zip This is a card reader api ,here is a sample code.When I run this code I got the error: ld: warning: ignoring file /Users/gaurav.garg/Downloads/99510108/SampleCode/Lib/libMTSCRA.a, missing required architecture i386 in file Undefined symbols for architecture i386: "_OBJC_CLASS_$_MTSCRA", referenced from: objc-class-ref in MagTekDemoAppDelegate.o ld: symbol(s) not found for architecture i386 clang: error: linker command failed with exit code 1 (use -v to see invocation) The class MTSCRA is only a header file,And the solution that I have cheked That we have to add the .m file in compiled source path of build build phase of target...but unfortunately I don't have the MTSCRA.m file.MTscra.h have the AudioToolBox and externalAccesory framework.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 1 2