Search Results

Search found 14975 results on 599 pages for 'os x'.

Page 208/599 | < Previous Page | 204 205 206 207 208 209 210 211 212 213 214 215  | Next Page >

• can I create disk partition for dual-boot Ubuntu on Windows 7 machine without Windows reinstall?

  - by EndangeringSpecies

  I want to setup dual boot Ubuntu on my machine in a separate partition. Plus, ideally, I want to get another, 3rd, partition for further OS experimentation. The hard drive is huge, hundreds of gigs, and essentially unfilled. The machine runs Windows 7 Home. Online I have seen mention of creation of partitions from inside Windows 7. But, I have also heard claims that to create the partition to house Ubuntu Windows has to be reinstalled, frying all the data on the machine. So, which one of these claims are right? Can you create additional partitions for other OS on a big Windows 7 hard drive without reinstall?

  Read the article

• SATA Devices not showing up when in UEFI mode

  - by Dan Barzilay

  I'm trying to install Windows and the bios should be set to UEFI mode. The problem is that all SATA devices aren't showing up (shows as if there aren't any) so I can't boot from the installation CD (it's just not there). The weird thing is that when set to LEGACY mode they all show up.. SATA mode is set to AHCI and I'm on Lenovo Y510P. I have a Linux OS installed that is accessible only when BIOS is in LEGACY mode (otherwise the hard drive it's on is not available) I also tried reseting the BIOS settings which didn't help.. Comment please if more details needed Extra details: Computer model: Lenovo IdeaPad Y510P (not overcloacked) Installed Linux OS version: Linux 3.7-trunk-amd64 x86_64 Trying to install Windows: Windows 7 Ultimate 64bit BIOS Information: Vendor: LENOVO Version: 74CN26WW(V1.07) Update: Using user1608638 answer and suggestion of using the USB flash drive as the boot device instead of the CD/DVD method I succeeded in installing Windows 7! (Thanks alot user1608638)

  Read the article

• In VirtualBox, how can I access host localhost from guest (Visual Studio Dev Server from IE7 testing VM)?

  - by Seth

  Host OS is Win7 running MyApp in the Visual Studio Development Server, bound to localhost:51227, VM is VirtualBox configured with NAT. Guest OS is Win XP with IE7 installed. My goal is to debug MyApp (running on host) from within IE7 (running on guest). Visual Studio Development server only binds to the loopback network device (i.e. localhost). It does not bind to the external IP address of my host. I've tried access 10.0.2.2:51227 from IE7 on the guest (and confirmed that 10.0.2.2 is the gateway address using ipconfig), but it appears that 10.0.2.2 binds to the external IP of the Host, NOT the loopback IP (localhost), so this does not work. Any suggestions?

  Read the article

• How do I add a boot from cd option to yaboot?

  - by Sergiu

  So I'm dual-booting Ubuntu 12.04.1 on my iMac G5 powepc alongside Mac OS X and I want to add a boot cd option to yaboot because I'm trying to boot a scratched Mac OS X installation DVD that takes a while to read and the frst bootstrap moves on too fast. How do I edit the timeout for the first bootstrap anyways? So, my main question is, how do I add a cd booting option to yaboot and then, how doI boot it? The devalias from OpenFrmware tells me that 1 have 2 cd-rom instaled, on is /ht/pci@3/ata-6/disk@0 and the other on ends with a 1 instead of a zero. These are the contents of my yaboot.conf file: yaboot.conf generated by the Ubuntu installer run: "man yaboot.conf" for details. Do not make changes until you have!! see also: /usr/share/doc/yaboot/examples for example configurations. For a dual-boot menu, add one or more of: bsd=/dev/hdaX, macos=/dev/hdaY, macosx=/dev/hdaZ boot="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part2" device=/ht@0,f2000000/pci@3/k2-sata-root@c/@0/@0 partition=4 root="UUID=798a048f-ee48-49e0-bba3-111aed8dee04" timeout=12000 install=/usr/lib/yaboot/yaboot magicboot=/usr/lib/yaboot/ofboot enablecdboot macosx="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part3" image=/boot/vmlinux label=Linux read-only initrd=/boot/initrd.img append="quiet splash" What do I add here so that yaboot will boot from my cd in like 3 minutes after startup? Thanks!

  Read the article

• turn off disable the performance cache

  - by jessie

  OK I run a streaming website and my CMS is giving me an error when uploading videos "Failed To Find Flength File" ok so I did some research. The answer I got from the coder was below. I did do all that, but the only thing I could not do is turn off what he refers to as performance cache, talked about in the last sentence... I am on a Cent OS Assuming the script is set up properly, you are probably dealing with some kind of write-caching. Some servers perform write-caching which prevents writing out the flength file or the entire CGITemp file during the upload. The flength file or the CGITemp file do not actually hit the disk until the upload is complete, making it worthless for reporting on progress during the upload. This may be fixed using a .htaccess file assuming your host supports them. Here is a link to an excellent tutorial on using .htaccess files. I strongly recommend giving it a quick read before attempting to install your own .htaccess file. 1. A mod_security module for Apache. To fix it just create a file called .htaccess (that's a period followed by "htaccess") and put the following lines in that file. Upload the file into the directory where the Uber-Uploader CGI ".pl" scripts resides, or in some directory above it (like your server's DOCUMENT_ROOT, i.e. the top-level of your webspace). htaccess files must be uploaded as ASCII mode, not BINARY. You may need to CHMOD the htaccess file to 644 or (RW-R--R--). # Turn off mod_security filtering. SecFilterEngine Off # The below probably isn't needed, # but better safe than sorry. SecFilterScanPOST Off If the above method does not work, try putting the following lines into the file SetEnvIfNoCase Content-Type \ "^multipart/form-data;" "MODSEC_NOPOSTBUFFERING=Do not buffer file uploads" mod_gzip_on No 2. "Performance Cache" enabled on OS X SERVER. If you're running OS X Server and the progress bar isn't working, it could be because of "performance caching." Apparently if ANY of your hosted sites are using performance caching, then by default, all sites (domains) will attempt to. The fix then is to disable the performance cache on all hosted sites.

  Read the article

• Installation on SSD with Windows preinstalled

  - by ebbot

  I bought a laptop with this fancy SSD drive, fancy new UEFI aso. I figured at first Windows out Ubuntu in but after doing 3 DoA on 3 laptops in one day I realized that maybe keeping Windows could come in handy. So dual boot it is. And this is what I've got: Disk 1 - 500 Gb HD 300 Mb Windoze only says "Healthy" don't know what it's for. 600 Mb "Healthy (EFI partition)" 186.30 Gb NTFS "OS (C:)" "Healthy (Boot, Page File, Crash Dump, Primary Partition)" 258.45 Gb NTFS "Data (D:)" "Healthy" 20.00 Gb "Healthy (Recovery Partition)" Disk 2 - 24 Gb SSD 4.00 Gb "Healthy (OEM Partition)" 18.36 Gb "Healthy (Primary Partition)" So I'm not sure what the first partition on each drive does (the 300 Gb on the HD and the OEM Partition on the SSD. Nor do I know what Data (D:). I think the 2nd partition on the SSD is for some speedup of Windoze. I'm debating if I should shrink the OS (C:) drive to around 120 GB or so. Clear the Data (D:) and also use the whole SSD for Ubuntu. That would leave me 24 Gb for e.g. / on the SSD and some 320 Gb on the HD for /home and swap. Is this a reasonable setup? Do I need to configure fstab for the SSD differently to a HD?

  Read the article

• How to install RAID drivers on already installed Windows 7?

  - by happysencha

  64-bit Windows 7 Ultimate 6GB RAM Intel i7 920 Intel X25-M SSD 80GB 2,5" Club 3D Radeon HD5750 GA-EX58-UD4P Motherboard I've been running fine with Windows 7 installed on the SSD. I wanted to create an mirrored Raid-1 setup for backups using two hard disks, so I ordered two Samsung HD203WI. This motherboard supports two different RAID controllers, the Intel's ICH10R and Gigabyte's SATA2 SATA controller. There are 6 SATA ports behind the ICH10R and 2 SATA ports for the Gigabyte controller. I googled around and seemed that the ICH10R is a better choice and since then I've been trying to make it work. When I activate the [RAID] mode from BIOS, the Windows 7 gives BSOD exactly as described by this guy: "Windows 7 will start to boot, it gets to the screen where there are 4 colors coming together and it blue screens and restarts no matter what I do." First thing I did: turned off the RAID and booted to Windows and tried to install the SATA RAID drivers from Gigabyte. I launch the driver installation program and it gives "This computer does not meet the minimum requirements for installing the software" error. I then tried Intel's Rapid Storage Technology drivers (which apparently is the same as the one offered at Gigabyte's site), but it resulted in exactly the same error. I then detached the new Samsung hard disks from the SATA ports, but left the [RAID] enabled in BIOS. To my surprise, it still BSOD'd, so at this point I knew it is an OS/driver issue. Also, I tried with the Gigabyte's RAID enabled (while the ICH10R RAID disabled) and it booted just fine. So then I thought, that maybe I can't install the RAID drivers from within the OS. So I caused the BSOD on purpose once again, and then with ICH10R RAID activated and Samsung hard disks attached, I choose the Windows 7 Recovery mode in the boot menu. It sees some problem(s), tries to repair, does not succeed and does not ask for drivers (which I put on a USB stick) to install. I also tried to use the command-line in the recovery: "rundll32 syssetup, SetupInfObjectInstallAction DefaultInstall 128 iaStor.inf" but it gave "Installation failed." So I'm clueless how should I proceed. Do I really need to re-install Windows 7 and load RAID drivers in the Win7 setup? I don't want to install any OS on the RAID, the Windows 7 is and will be on the SSD. I just want to have a RAID-1 backup using those two hard disks. I mean why would I need to re-install operating system to add RAID setup?

  Read the article

• How to install windows on a server with no CD or DVD drive

  - by user29266

  I've found a few posts on this site, however my situation is different. I have a new Dell server with no OS installed. I would like to install Windows 2008 Web Edition. I have a few USB ports and Ethernet. No CD or DVD drives. Is this article the best & only way to proceed? Installing Windows 2008 via USB thumbdrive or should I just get a external hardrive and hook it up to a usb. Once the OS is installed I'll never need a DVD drive again - so that's idea is a waste of money.

  Read the article

• Can I delete the OEM partition on the new Dell XPS 15?

  - by timepilot

  My new Dell XPS 15 L521X just arrived. I need to set this up to dual boot Linux. Sadly, the system comes with four primary partitions. I can't do a clean install at the moment, so one of the partitions will have to be deleted before I can install Linux. The layout is as follows: OEM: 39mb Hibernation: 8gb OS: 457gb Recovery: 12gb Obviously, I can't delete the Hibernation and OS partitions (will shrink to make space for Linux) and I'd like to keep the recovery partition if possible. So my question is what is on the small OEM partition? What functionality will I lose if I delete it?

  Read the article

• Dual boot centOS and Win7

  - by user1855965

  I posted this on stackoverflow, but it looks like superuser would be more appropriate. I have a CentOS 5 machine that runs Windows 7 as a dual boot. CentOS is the main OS and each OS is set up in a specific hard drive. This was set up before I joined the company and I don't really have need to run Windows now. My question is: can I, from CentOS, reformat the Windows HD, change GRUB settings and get the HD to be available on CentOS? Happy to provide more info if this helps. Many thanks for your help and apologies if this is a very simple issue... I don't want to blindly test things on this machine as it is used on a daily basis by several users.

  Read the article

• Operating Systems supported by the Intel SR1435VP2 Server Platform?

  - by Xspence

  I recently had two Intel SR1435VP2 Servers (with SE7320VP2 server boards) donated to me from a colleague. Google hasn't yielded much more than user manuals when searching for OS-compatibility answers. I have worked with flavors of Linux such as Ubuntu and Debian, but Intel only documents that they have tested proprietary operating systems such as SuSE, Solaris and Red Hat as documented on their driver downloads page. Has anyone worked with these machines before, and if so, do you know if the SR1435VP2/E7320 chipset supports OS's such as CentOS, Debian or Ubuntu? If you need more information or clarification, let me know. This is all new for me. Thanks in advance.

  Read the article

• Computer temporarily freezes and then resumes

  - by trizicus

  This happens on ALL operating systems (7, Ubuntu, etc.). What happens is everything for 1-3 seconds becomes unresponsive, I then hear what sounds like my other internal hard drive 'spinning up', and then viola everything is responsive again. Note: Already ran SMART tests, no issues at all. I think issue is that the HDD spins down and when need it gets 'turned-on' (OS settings turn off HDD's after 20 mins of inactivity) and because my pagefile is on the other HDD it causes OS to temporarily freeze. Need more tips, and insight. Thanks More info: Running Quad CPU, 4GB RAM, Intel SSD, GT 240.

  Read the article

• How can I pin point a USB file transfer bottleneck in Unix?

  - by HankHendrix

  I'm experiencing very slow data transfer speeds over USB 2.0 on my nix box and was wondering how I can pin-point the cause of the problem. I've looked into iotop and top but the cpu and mem figures look normal (compared to guides I have checked). The box which is affected is Ubuntu 12.04 32bit Server running on an Asus EEE 701 2G model and I am transferring from the OS over USB 2.0 to an external HDD (which transfers at 30MB/s+ on Windows 7 on other machine). I get rsync write speeds of 1MB/s from OS to USB HDD which seems ridiculously slow. These speeds are consistent with other USB HDDs and sticks.

  Read the article

• What are the major distinctions between PureDarwin and FreeBSD?

  - by ??????? ???????????

  I'm looking to install a different unix on my workstation to acquire some perspective on GNU/Linux and out of curiosity. I have narrowed my options down to these two. The reason for considering PureDarwin is because I have very little experience with Apple's products. So my question is will installing and using PureDarwin give me a closer understanding of OSX than would running FreeBSD? What I have in mind are day to day routines like adding users, installing software and configuring various aspects of the underlying OS. I know that the GUI of OSX would not be available, but that is not a concern. As a secondary, less important question, can I buy OS X in the apple store and run it in a virtual machine or does that violate their EULA?

  Read the article

• How to partition my hard drive, quicker?

  - by Sam

  When I install Windows 7 on my hard drive, it makes three partitions. One with the OS itself, one with bootmgr inside (that is 100 MiB), and one with the factory image (all the crapware from HP). My final goal is to have the OS on a partition of 100 GiB and keep the rest (900 GiB) for storage. I thought it would be easy using gparted, but it is taking so long. It will take hours. There must a way to partition the drive before installing Windows. Yeah, because what I think makes the shrinking/moving of the partitions take so long is because they are not empty (am I wrong?).

  Read the article

• Is it OK to create all primary partitions.?

  - by james

  I have a 320GB hard disk. I only use either ubuntu or kubuntu (12.04 for now). I don't want to use windows or any other dual boot os. And i need only 3 partitions on my hard disk. One for the OS and remaining two for data storage. I don't want to create swap also. Now can i create all primary partitions on the hard disk. Are there any disadvantages in doing so. If all the partitions are primary i think i can easily resize partitions in future. On second thought i have the idea of using seperate partition for /home. Is it good practice . If i have to do this, i will create 4 partitions all primary. In any case i don't want to create more than 4 partitions . And i know the limit will be 4. So is it safe to create all 3 or 4 primary partitions. Pls suggest me, What are the good practices . (previously i used win-xp and win-7 on dual boot with 2 primary partitions and that bugged me somehow i don't remember. Since then i felt there should be only one primary partition in a hard disk.) EDIT 1 : Now i will use four partitions in the sequence - / , /home , /for-data , /swap . I have another question. Does a partition need continuous blocks on the disk. I mean if i want to resize partitions later, can i add space from sda3 to sda1. Is it possible and is it safe to do ?

  Read the article

• Blacklist a single access point of a wireless network

  - by Zr40

  At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

  Read the article

• Eclipse Juno Switch Editor in Order

  - by inspectorG4dget

  In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

  Read the article

• node.js server not running

  - by CMDadabo

  I am trying to learn node.js, but I'm having trouble getting the simple server to run on localhost:8888. Here is the code for server.js: var http = require("http"); http.createServer(function(request, response) { response.writeHead(200, {"Content-Type": "text/plain"}); response.write("Hello World"); response.end(); }).listen(8888); server.js runs without errors, and trying netstat -an | grep 8888 from terminal returns tcp4 0 0 *.8888 *.* LISTEN However, when I go to localhost:8888 in a browser, it says that it cannot be found. I've looked at all the related questions, and nothing has worked so far. I've tried different ports, etc. I know that my router blocks incoming traffic on port 8888, but shouldn't that not matter if I'm trying to access it locally? I've run tomcat servers on this port before, for example. Thanks so much for your help! node.js version: v0.6.15 OS: Mac OS 10.6.8

  Read the article

• Solaris 11 installed, no updates?

  - by Paul De Niro

  I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Starting VM as an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Why am I getting [mount error(22): Invalid argument] while trying to mount SMB network drive?

  - by Steve_

  Disclaimer: I am very new to Linux :) Anyway, onward: I have a fresh instance of Ubuntu Server (12.04.1 LTS) running on my network and I want to mount a network drive to the server so I can access the contents. The network drive is a SAMBA compatible drive running Darwin OS. If I run the following command: smbclient -L //192.168.0.2 -U myuser It prompts me for the password and then displays output similar to: Domain=[SERVER01] OS=[Darwin] Server=[@(#)PROGRAM:smbd PROJECT:smbx-105.4.0] Sharename Type Comment --------- ---- ------- Comp Staff's Public Folder Disk CompRaid03 Disk Dropbox Disk Groups Disk IPC$ IPC Public Disk Users Disk compstaff Disk However, when I try and mount the CompRaid03 share, using this command: sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/myshare -o username=myuser I get the same password prompt, but after putting the correct password in, I received this error: mount error(22): Invalid argument dmesg | tail returns: [23576.037373] CIFS VFS: cifs_mount failed w/return code = -22 I don't understand what is wrong with this command. I've managed to mount a share on my current (Windows 8) machine using basically the same command but with a different IP address and share name (obviously). I've spent a good few hours trying to solve this and got no where. Any help or pointers would be greatly appreciated. Thanks Steve EDIT As suggested I've also trued using "user=" instead of "username=": sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/svnrepo -o user=myuser This results in the same "Invalid argument" error.

  Read the article

• Compiz problems in Ubuntu 12.10

  - by Antonio Raffaele Iannaccone

  I have installed ubuntu 12.10 x64 on my notebook and I wanted to make a little customization in the UI, so i downloaded Compiz Settings Manager and opened it up. Once I opened it up, I found out that in the compiz are not all those settings and animations (that I could apply like on the photos, videos etc.) so I reinstalled it few times. Once I get bored with the reinstalling I checked one field in there and Ubuntu (OS) started to get "lagged" (Dash get hid, OS started to do not respond very well). So please, can anyone help me? How can I customize my ubuntu without get lagged and with all the animations that have to be available in the compiz? Thanks to all! thank you! It seems that it helped to fix the Dash-hide problem, but I still do not have all the animations and features that have to be in the Compiz (program). Can you help me with this too please? Thanks a lot!

  Read the article

• Multi-monitor resolution and position settings lost after reboot

  - by SoftDeveloper

  I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

  Read the article

< Previous Page | 204 205 206 207 208 209 210 211 212 213 214 215  | Next Page >