Search Results

Search found 5542 results on 222 pages for 'cross compiling'.

Page 209/222 | < Previous Page | 205 206 207 208 209 210 211 212 213 214 215 216  | Next Page >

  • Lazy loading the addthis script? (or lazy loading external js content dependent on already fired eve

    - by Keith Bentrup
    I want to have the addthis widget available for my users, but I want to lazy load it so that my page loads as quickly as possible. However, after trying it via a script tag and then via my lazy loading method, it appears to only work via the script tag. In the obfuscated code, I see something that looks like it's dependent on the DOMContentLoaded event (at least for firefox). Since the DOMContentLoaded event has already fired, the widget doesn't render properly. What to do? I could just use a script tag (slower)... or could I fire (in a cross browser way) the DOMContentLoaded (or equivalent) event? I have a feeling this may not be possible b/c I believe that (like jQuery) there are multiple tests of the content ready event, and so multiple simulated events would have to occur. Nonetheless, this is an interesting problem b/c I have seen a couple widgets now assume that you are including their stuff via static script tags. It would be nice if they wrote code that was more useful to developers concerned about speed, but until then, is there a work around?? And/or are any of my assumptions wrong? Edit: Because the 1st answer to the question seemed to miss the point of my problem, I wanted to clarify the situation. This is about a specific problem. I'm not looking for yet another lazy load script or check if some dependencies are loaded script. Specifically this problem deals with external widgets that you do not have control over and may or may not be obfuscated delaying the load of the external widgets until they are needed or at least, til substantially after everything else has been loaded including other deferred elements b/c of the how the widget was written, precludes existing, typical lazy loading paradigms While it's esoteric, I have seen it happen with a couple widgets - where the widget developers assume that you're just willing to throw in another script tag at the bottom of the page. I'm looking to save those 500-1000 ms** though as numerous studies by yahoo, google, and amazon show it to be important to your user's experience. **My testing with hammerhead and personal experience indicates that this will be my savings in this case.

    Read the article

  • Best Practices / Patterns for Enterprise Protection/Remediation of SSNs (Social Security Numbers)

    - by Erik Neu
    I am interested in hearing about enterprise solutions for SSN handling. (I looked pretty hard for any pre-existing post on SO, including reviewing the terriffic SO automated "Related Questions" list, and did not find anything, so hopefully this is not a repeat.) First, I think it is important to enumerate the reasons systems/databases use SSNs: (note—these are reasons for de facto current state—I understand that many of them are not good reasons) Required for Interaction with External Entities. This is the most valid case—where external entities your system interfaces with require an SSN. This would typically be government, tax and financial. SSN is used to ensure system-wide uniqueness. SSN has become the default foreign key used internally within the enterprise, to perform cross-system joins. SSN is used for user authentication (e.g., log-on) The enterprise solution that seems optimum to me is to create a single SSN repository that is accessed by all applications needing to look up SSN info. This repository substitutes a globally unique, random 9-digit number (ASN) for the true SSN. I see many benefits to this approach. First of all, it is obviously highly backwards-compatible—all your systems "just" have to go through a major, synchronized, one-time data-cleansing exercise, where they replace the real SSN with the alternate ASN. Also, it is centralized, so it minimizes the scope for inspection and compliance. (Obviously, as a negative, it also creates a single point of failure.) This approach would solve issues 2 and 3, without ever requiring lookups to get the real SSN. For issue #1, authorized systems could provide an ASN, and be returned the real SSN. This would of course be done over secure connections, and the requesting systems would never persist the full SSN. Also, if the requesting system only needs the last 4 digits of the SSN, then that is all that would ever be passed. Issue #4 could be handled the same way as issue #1, though obviously the best thing would be to move away from having users supply an SSN for log-on. There are a couple of papers on this: UC Berkely: http://bit.ly/bdZPjQ Oracle Vault: bit.ly/cikbi1

    Read the article

  • Unique element ID, even if element doesn't have one

    - by Robert J. Walker
    I'm writing a GreaseMonkey script where I'm iterating through a bunch of elements. For each element, I need a string ID that I can use to reference that element later. The element itself doesn't have an id attribute, and I can't modify the original document to give it one (although I can make DOM changes in my script). I can't store the references in my script because when I need them, the GreaseMonkey script itself will have gone out of scope. Is there some way to get at an "internal" ID that the browser uses, for example? A Firefox-only solution is fine; a cross-browser solution that could be applied in other scenarios would be awesome. Edit: If the GreaseMonkey script is out of scope, how are you referencing the elements later? They GreaseMonkey script is adding events to DOM objects. I can't store the references in an array or some other similar mechanism because when the event fires, the array will be gone because the GreaseMonkey script will have gone out of scope. So the event needs some way to know about the element reference that the script had when the event was attached. And the element in question is not the one to which it is attached. Can't you just use a custom property on the element? Yes, but the problem is on the lookup. I'd have to resort to iterating through all the elements looking for the one that has that custom property set to the desired id. That would work, sure, but in large documents it could be very time consuming. I'm looking for something where the browser can do the lookup grunt work. Wait, can you or can you not modify the document? I can't modify the source document, but I can make DOM changes in the script. I'll clarify in the question. Can you not use closures? Closuses did turn out to work, although I initially thought they wouldn't. See my later post. It sounds like the answer to the question: "Is there some internal browser ID I could use?" is "No."

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C++ destructor seems to be called 'early'

    - by suicideducky
    Please see the "edit" section for the updated information. Sorry for yet another C++ dtor question... However I can't seem to find one exactly like mine as all the others are assigning to STL containers (that will delete objects itself) whereas mine is to an array of pointers. So I have the following code fragment #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } }; template <class T> class Octree{ T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(){ for( int i=0; i<8; i++ ) children[i] = new T; } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Looking through the output I notice that the destructor is being called many times before I think it should (as Octree is still in scope), the end of the output also shows: del:0 del:0 del:1 del:2 del:3 Process returned -1073741819 (0xC0000005) execution time : 1.685 s Press any key to continue. For some reason the destructor is going through the same point in the loop twice (0) and then dying. All of this occures before the "nothing seems to have gone wrong" line which I expected before any dtor was called. Thanks in advance :) EDIT The code I posted has some things removed that I thought were unnecessary but after copying and compiling the code I pasted I no longer get the error. What I removed was other integer attributes of the code. Here is the origional: #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } Block(int xx, int yy, int zz, int ty){ x=xx; y=yy; z=zz; type=ty; } Block(int xx, int yy, int zz){ x=xx; y=yy; z=zz; type=0; } }; template <class T> class Octree{ int x, y, z; int size; T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(int xx, int yy, int zz, int size){ x=xx; y=yy; z=zz; size=size; for( int i=0; i<8; i++ ) children[i] = new T; } Octree(){ Octree(0, 0, 0, 10); } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Also, as for the problems with set_child, get_child and swap_child leading to possible memory leaks this will be solved as a wrapper class will either use get before set or use swap to get the old child and write this out to disk before freeing the memory itself. I am glad that it is not my memory management failing but rather another error. I have not made a copy and/or assignment operator yet as I was just testing the block tree out, I will almost certainly make them all private very soon. This version spits out -1073741819. Thank you all for your suggestions and I apologise for highjacking my own thread :$

    Read the article

  • CLR 4.0 inlining policy? (maybe bug with MethodImplOptions.NoInlining)

    - by ControlFlow
    I've testing some new CLR 4.0 behavior in method inlining (cross-assembly inlining) and found some strage results: Assembly ClassLib.dll: using System.Diagnostics; using System; using System.Reflection; using System.Security; using System.Runtime.CompilerServices; namespace ClassLib { public static class A { static readonly MethodInfo GetExecuting = typeof(Assembly).GetMethod("GetExecutingAssembly"); public static Assembly Foo(out StackTrace stack) // 13 bytes { // explicit call to GetExecutingAssembly() stack = new StackTrace(); return Assembly.GetExecutingAssembly(); } public static Assembly Bar(out StackTrace stack) // 25 bytes { // reflection call to GetExecutingAssembly() stack = new StackTrace(); return (Assembly) GetExecuting.Invoke(null, null); } public static Assembly Baz(out StackTrace stack) // 9 bytes { stack = new StackTrace(); return null; } public static Assembly Bob(out StackTrace stack) // 13 bytes { // call of non-inlinable method! return SomeSecurityCriticalMethod(out stack); } [SecurityCritical, MethodImpl(MethodImplOptions.NoInlining)] static Assembly SomeSecurityCriticalMethod(out StackTrace stack) { stack = new StackTrace(); return Assembly.GetExecutingAssembly(); } } } Assembly ConsoleApp.exe using System; using ClassLib; using System.Diagnostics; class Program { static void Main() { Console.WriteLine("runtime: {0}", Environment.Version); StackTrace stack; Console.WriteLine("Foo: {0}\n{1}", A.Foo(out stack), stack); Console.WriteLine("Bar: {0}\n{1}", A.Bar(out stack), stack); Console.WriteLine("Baz: {0}\n{1}", A.Baz(out stack), stack); Console.WriteLine("Bob: {0}\n{1}", A.Bob(out stack), stack); } } Results: runtime: 4.0.30128.1 Foo: ClassLib, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null at ClassLib.A.Foo(StackTrace& stack) at Program.Main() Bar: ClassLib, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null at ClassLib.A.Bar(StackTrace& stack) at Program.Main() Baz: at Program.Main() Bob: ClassLib, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null at Program.Main() So questions are: Why JIT does not inlined Foo and Bar calls as Baz does? They are lower than 32 bytes of IL and are good candidates for inlining. Why JIT inlined call of Bob and inner call of SomeSecurityCriticalMethod that is marked with the [MethodImpl(MethodImplOptions.NoInlining)] attribute? Why GetExecutingAssembly returns a valid assembly when is called by inlined Baz and SomeSecurityCriticalMethod methods? I've expect that it performs the stack walk to detect the executing assembly, but stack will contains only Program.Main() call and no methods of ClassLib assenbly, to ConsoleApp should be returned.

    Read the article

  • Hard to append a table with many records into another without generating duplicates

    - by Bill Mudry
    I may seem to be a bit wordy at first but for the hope it will be easier for all of you to understand what I am doing in the first place. I have an uncommon but enjoyable activity of collecting as many species of wood from around the world as I can (over 2,900 so far). Ok, that is the real world. Meanwhile I have spent over 8 years compiling over 5.8 meg of text data on all the woods of the world. That got so large that learning some basic PHP and MySQL was most welcome so I could build a new database driven home for all this research. I am still slow at it but getting there. The original premise was to find evidence of as many species of woods in the world I can. The more names identified, the more successful the project. I have named the project TAXA for ease of conversation (short for Taxonomy). You are most welcome to take a look at what I have so far at www.prowebcanada.com/taxa. It is 95% dynamically driven. So far I am reporting about 6,500 botanical wood names and, as said above, the more I can report, the more successful is the project. I have a file of all the woods in the second largest wood collection in the world, the Tervuren wood collection in the Netherlands with over 11,300 wood names even after cleaning out all duplicates. That is almost twice the number I am reporting now so porting all the new wood names from Tervuren to the 'species' table where I keep the reported data would be a major desirable advancement in the project. At one point I was able to add all the Tervuren records to the species table but over 3,000 duplicates also formed. They were not in the Tervuren file in the first place but represent the same wood names common to both files. It is common sense that there would be woods common to both that when merged would create new duplicates. At one point and with the help of others from another forum, I may very well have finally got the proper SQL statement. When I ran it, though, the system said (semi-amusingly at first) ----- that it had gone away! After looking up on the Net what could have have done this, one reason is that the MySQL timeout lapses and probably because of the large size of files I am running. I am running this on a rented account on Godaddy so I cannot go about trying to adjust any config file. For safety, I copied the tervuren.sql file as tervuren_target.sql and the species.sql file as species_master.sql tp use as working files just to make sure I protect the original files from destruction or damage. Later I can name the species_master back to just species.sql once I am happy all worked well. The species file has about 18 columns in it but only 5 columns match the columns in the Tervuren file (name for name and collation also). The rest of the columns are just along for the ride, so to speak. The common key in both is the 'species_name" columns in both. I am not sure it is at all proper to call one a primary key and the other a foreign key since there really is no relational connection to them. One is just more data for the other and can disappear after, never to be referred to the working code in the application. I have been very surprised and flabbergasted on how hard it can be to append records from one large table into another (with same column names plus others) without generating NEW duplicates in the first place. Watch out thinking that a SELECT DISTINCT statement may do the job because absolutely NO records in the species table must get destroyed in the process and there is no way (well, that I know of) to tell the 'DISTINCT" command this. Yes, the original 'species' table has duplicates in it even before all this but, trust me ---- they have to be removed the long hard way manually record by record or I will lose precious information. It is more important to just make sure no NEW duplicates form through bringing in new names in the tervuren_target.species_name into species.species_name. I am hoping and thinking that a straight SQL solution should work --- except for that nasty timeout. How do I get past that? Could it mean that I may have to turn to a PHP plus SQL method?? Or ..... would I have to break up the Tervuren files into a few smaller ones and run them independently (hope not....)" So far, what seems should be easy has proven to be unexpectedly tricky. I appreciate any help you can give but start from the assumption that this may be harder to do right than it may seem on the surface. By the way --- I am running a quad 64 bit system with Windows 7, so at least I have some fairly hefty power on the client end. I have a direct ethernet cable feeding a cable connection to the Internet. Once I get an algorithm and code working for this, I also have many other lists to process that could make the 'species' table grow even more. It could be equivalent to (ahem) lighting a rocket under my project (especially compared to do this record by record manually)! This is my first time in this forum, so I do not know how I can receive any replies. Do I have to to come back here periodically or are replies emailed out also? It would be great if you CC'd copies to me at billmudry at rogers.com :-) Much thanks for your patience and help, Bill Mudry Mississauga, Ontario Canada (next to Toronto).

    Read the article

  • PDF Report generation

    - by IniTech
    EDIT : I completed this project using ABCpdf. For anyone interested, I love this product and their support is A+. Everything I listed as a 'Con' for the HTML - PDF solution was easily doable in ABCpdf. I've been charged with creating a data driven pdf report. After reviewing the plethora of options, I have narrowed it down to 2. I need you all to to help me decide, or offer alternatives I haven't considered. Here are the requirements: 100% Data driven Eventually PDF (a stop in HTML is fine, so long as it is converted) Can be run with multiple sets of data (the layout is always the same, the data is variable) Contains normal analysis-style copy (saved in DB with html markup) Contains tables (data for tables is generated at run-time) Header/Page # on each page Table of Contents .NET (VB or C#) Done quickly Now, because of the fact that the report is going to be generated with multiple sets of data, I don't think a stamped pdf template will work since I won't know how long or how many pages a certain piece of the report could require. So, I think my best options are: Programmatic creation using an iText-like solution. Generate in HTML and convert to PDF using a third-party application (ABCPdf is the tool I have played with so far) Both solutions have their pro's and con's. Programmatic solution: Pros: Flexible Easy page numbering/page header/table of contents Free Cons: Time consuming (to write a layer on top of iText to do what I need and keep maintainable) Since the copy is already stored in the db with html markup, I would have to parse through the data before I place it into the pdf, ensuring I don't have to break the paragraph into chunks so I can apply bold, italic, underline, etc. to specific phrases. This seems like a huge PITA, and I hope I am wrong about that assumption. HTML - PDF Pros: Easy to generate from db (no parsing necessary) Many tools for conversion Uses technology I am already familiar with Built-in "Print Preview" - not a req, but nice Cons: (Edited after project completion. All of my assumptions were incorrect and ABCpdf is awesome) 1. Almost impossible to generate page headers - Not True 2. Very difficult to generate page numbers Not True 3. Nearly impossible to generate table of contents Not True 4. (Cross-browser support isn't a con; Since its internal, I can dictate what browser to use) 5. Conversion tool quirks - may not convert exactly as rendered in browser Not True 6. Overall, I think it would be very hard to format the HTML exactly as I would want it to appear/convert to PDF. Not True That's it - I need the communitys help in deciding which way I should go. I might be wrong about some of my Pro/Con assumptions. If I am, please tell me. All thoughts and suggestions are welcome and appreciated. Thanks

    Read the article

  • Escaping Code for Different Shells

    - by Jon Purdy
    Question: What characters do I need to escape in a user-entered string to securely pass it into shells on Windows and Unix? What shell differences and version differences should be taken into account? Can I use printf "%q" somehow, and is that reliable across shells? Backstory (a.k.a. Shameless Self-Promotion): I made a little DSL, the Vision Web Template Language, which allows the user to create templates for X(HT)ML documents and fragments, then automatically fill them in with content. It's designed to separate template logic from dynamic content generation, in the same way that CSS is used to separate markup from presentation. In order to generate dynamic content, a Vision script must defer to a program written in a language that can handle the generation logic, such as Perl or Python. (Aside: using PHP is also possible, but Vision is intended to solve some of the very problems that PHP perpetuates.) In order to do this, the script makes use of the @system directive, which executes a shell command and expands to its output. (Platform-specific generation can be handled using @unix or @windows, which only expand on the proper platform.) The problem is obvious, I should think: test.htm: <!-- ... --> <form action="login.vis" method="POST"> <input type="text" name="USERNAME"/> <input type="password" name="PASSWORD"/> </form> <!-- ... --> login.vis: #!/usr/bin/vision # Think USERNAME = ";rm -f;" @system './login.pl' { USERNAME; PASSWORD } One way to safeguard against this kind of attack is to set proper permissions on scripts and directories, but Web developers may not always set things up correctly, and the naive developer should get just as much security as the experienced one. The solution, logically, is to include a @quote directive that produces a properly escaped string for the current platform. @system './login.pl' { @quote : USERNAME; @quote : PASSWORD } But what should @quote actually do? It needs to be both cross-platform and secure, and I don't want to create terrible problems with a naive implementation. Any thoughts?

    Read the article

  • JavaScript: How to get text from all descendents of an element, disregarding scripts?

    - by Bungle
    My current project involves gathering text content from an element and all of its descendents, based on a provided selector. For example, when supplied the selector #content and run against this HTML: <div id="content"> <p>This is some text.</p> <script type="text/javascript"> var test = true; </script> <p>This is some more text.</p> </div> my script would return (after a little whitespace cleanup): This is some text. var test = true; This is some more text. However, I need to disregard text nodes that occur within <script> elements. This is an excerpt of my current code: // get text content of all matching elements for (x = 0; x < selectors.length; x++) { matches = Sizzle(selectors[x], document); for (y = 0; y < matches.length; y++) { match = matches[y]; if (match.innerText) { // IE content += match.innerText + ' '; } else if (match.textContent) { // other browsers content += match.textContent + ' '; } } } It's a bit overly simplistic in that it just returns all text nodes within the element (and its descendants) that matches the provided selector. The solution I'm looking for would return all text nodes except for those that fall within script elements. It doesn't need to be especially high-performance, but I do need it to ultimately be cross-browser compatible. I'm assuming that I'll need to somehow loop through all children of the element that matches the selector and accumulate all text nodes other than ones within <script> elements; it doesn't look like there's any way to identify JavaScript once it's already rolled into the string accumulated from all of the text nodes. I can't use jQuery (for performance/bandwidth reasons), although you may have noticed that I do use its Sizzle selector engine, so jQuery's selector logic is available. Thanks in advance for any help!

    Read the article

  • C++: Declaration of template class member specialization (+ Doxygen bonus question!)

    - by Ziv
    When I specialize a (static) member function/constant in a template class, I'm confused as to where the declaration is meant to go. Here's an example of what I what to do - yoinked directly from IBM's reference on template specialization: template<class T> class X { public: static T v; static void f(T); }; template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } template<> char* X<char*>::v = "Hello"; template<> void X<float>::f(float arg) { v = arg * 2; } int main() { X<char*> a, b; X<float> c; c.f(10); // X<float>::v now set to 20 } The question is, how do I divide this into header/cpp files? The generic implementation is obviously in the header, but what about the specialization? It can't go in the header file, because it's concrete, leading to multiple definition. But if it goes into the .cpp file, is code which calls X::f() aware of the specialization, or might it rely on the generic X::f()? So far I've got the specialization in the .cpp only, with no declaration in the header. I'm not having trouble compiling or even running my code (on gcc, don't remember the version at the moment), and it behaves as expected - recognizing the specialization. But A) I'm not sure this is correct, and I'd like to know what is, and B) my Doxygen documentation comes out wonky and very misleading (more on that in a moment). What seems most natural to me would be something like this, declaring the specialization in the header and defining it in the .cpp: ===XClass.hpp=== #ifndef XCLASS_HPP #define XCLASS_HPP template<class T> class X { public: static T v; static void f(T); }; template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } /* declaration of specialized functions */ template<> char* X<char*>::v; template<> void X<float>::f(float arg); #endif ===XClass.cpp=== #include <XClass.hpp> /* concrete implementation of specialized functions */ template<> char* X<char*>::v = "Hello"; template<> void X<float>::f(float arg) { v = arg * 2; } ...but I have no idea if this is correct. The most immediate consequence of this issue, as I mentioned, is my Doxygen documentation, which doesn't seem to warm to the idea of member specialization, at least the way I'm defining it at the moment. It will always present only the first definition it finds of a function/constant, and I really need to be able to present the specializations as well. If I go so far as to re-declare the entire class, i.e. in the header: /* template declaration */ template<class T> class X { public: static T v; static void f(T); }; /* template member definition */ template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } /* declaration of specialized CLASS (with definitions in .cpp) */ template<> class X<float> { public: static float v; static void f(float); }; then it will display the different variations of X as different classes (which is fine by me), but I don't know how to get the same effect when specializing only a few select members of the class. I don't know if this is a mistake of mine, or a limitation of Doxygen - any ideas? Thanks much, Ziv

    Read the article

  • Recommendations for a free GIS library supporting raster images

    - by gspr
    Hi. I'm quite new to the whole field of GIS, and I'm about to make a small program that essentially overlays GPS tracks on a map together with some other annotations. I primarily need to allow scanned (thus raster) maps (although it would be nice to support proper map formats and something like OpenStreetmap in the long run). My first exploratory program uses Qt's graphics view framework and overlays the GPS points by simply projecting them onto the tangent plane to the WGS84 ellipsoid at a calibration point. This gives half-decent accuracy, and actually looks good. But then I started wondering. To get the accuracy I need (i.e. remove the "half" in "half-decent"), I have to correct for the map projection. While the math is not a problem in itself, supporting many map projection feels like needless work. Even though a few projections would probably be enough, I started thinking about just using something like the PROJ.4 library to do my projections. But then, why not take it all the way? Perhaps I might aswell use a full-blown map library such as Mapnik (edit: Quantum GIS also looks very nice), which will probably pay off when I start to want even more fancy annotations or some other symptom of featuritis. So, finally, to the question: What would you do? Would you use a full-blown map library? If so, which one? Again, it's important that it supports using (and zooming in and out with) raster maps and has pretty overlay features. Or would you just keep it simple, and go with Qt's own graphics view framework together with something like PROJ.4 to handle the map projections? I appreciate any feedback! Some technicalities: I'm writing in C++ with a Qt-based GUI, so I'd prefer something that plays relatively nicely with those. Also, the library must be free software (as in FOSS), and at least decently cross-platform (GNU/Linux, Windows and Mac, at least). Edit: OK, it seems I didn't do quite enough research before asking this question. Both Quantum GIS and Mapnik seem very well suited for my purpose. The former especially so since it's based on Qt.

    Read the article

  • (resolved) empty response body in ajax (or 206 Partial Content)

    - by Nikita Rybak
    Hi guys, I'm feeling completely stupid because I've spent two hours solving task which should be very simple and which I solved many times before. But now I'm not even sure in which direction to dig. I fail to fetch static content using ajax from local servers (Apache and Mongrel). I get responses 200 and 206 (depending on the server), empty response text (although Content-Length header is always correct), firebug shows request in red. Javascript is very generic, I'm getting same results even here: http://www.w3schools.com/ajax/tryit.asp?filename=tryajax_first (just change document location to 'http://localhost:3000/whatever') So, it's probably not the cause. Well, now I'm out of ideas. I can also post http headers, if it'll help. Thanks! Response Headers Connection close Date Sat, 01 May 2010 21:05:23 GMT Last-Modified Sun, 18 Apr 2010 19:33:26 GMT Content-Type text/html Content-Length 7466 Request Headers Host localhost:3000 User-Agent Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.6; en-US; rv:1.9.2.3) Gecko/20100401 Firefox/3.6.3 Accept text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 Accept-Language en-us,en;q=0.5 Accept-Encoding gzip,deflate Accept-Charset ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive 115 Connection keep-alive Referer http://www.w3schools.com/ajax/tryit_view.asp Origin http://www.w3schools.com Response Headers Date Sat, 01 May 2010 21:54:59 GMT Server Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 mod_jk/1.2.28 Etag "3d5cbdb-fb4-4819c460d4a40" Accept-Ranges bytes Content-Length 4020 Cache-Control max-age=7200, public, proxy-revalidate Expires Sat, 01 May 2010 23:54:59 GMT Content-Range bytes 0-4019/4020 Keep-Alive timeout=5, max=100 Connection Keep-Alive Content-Type application/javascript Request Headers Host localhost User-Agent Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.6; en-US; rv:1.9.2.3) Gecko/20100401 Firefox/3.6.3 Accept text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 Accept-Language en-us,en;q=0.5 Accept-Encoding gzip,deflate Accept-Charset ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive 115 Connection keep-alive Origin null UPDATED: I've found a problem, it was about cross-domain requests. I knew that there are restrictions, but thought they're relaxed for local filesystem and local servers. (and expected more descriptive error message, anyway) Thanks everybody!

    Read the article

  • Embedding mercurial revision information in Visual Studio c# projects automatically

    - by Mark Booth
    Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

    Read the article

  • Ado.Net Entity produces "namespace cannot be found"

    - by Dave
    I've seen several possible solutions to this, but none have worked for me. After adding a ADO.NET Entity Data Model to my .Net Forms C# web project, I am unable to use it. Perhaps I made a mistake adding it? The name of the file added is QcFormData.edmx. In my code, perhaps I'm instantiating it incorrectly? I tried adding the line: QcFormDataContainer db = new QcFormDataContainer(); It appears in Intellisense, but when compiling I get the error : Error 13 The type or namespace name 'QcFormDataContainer' could not be found (are you missing a using directive or an assembly reference?) I've followed the suggestions that I found online that did not help: 1) made sure there is "using System.Data.Entity" 2) made sure the dll exists. 3) made sure the reference exists. 4) one post said use using System.Web.Data.Entity; but I do not see that available. What am I missing? QcFormData.edmx <?xml version="1.0" encoding="utf-8"?> <edmx:Edmx Version="3.0" xmlns:edmx="http://schemas.microsoft.com/ado/2009/11/edmx"> <!-- EF Runtime content --> <edmx:Runtime> <!-- SSDL content --> <edmx:StorageModels> <Schema Namespace="MyCocoModel.Store" Alias="Self" Provider="System.Data.SqlClient" ProviderManifestToken="2008" xmlns:store="http://schemas.microsoft.com/ado/2007/12/edm/EntityStoreSchemaGenerator" xmlns="http://schemas.microsoft.com/ado/2009/11/edm/ssdl"> <EntityContainer Name="MyCocoModelStoreContainer"> <EntitySet Name="QcFieldValues" EntityType="MyCocoModel.Store.QcFieldValues" store:Type="Tables" Schema="dbo" /> </EntityContainer> <EntityType Name="QcFieldValues"> <Key> <PropertyRef Name="ID" /> </Key> <Property Name="ID" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="FieldID" Type="nvarchar" MaxLength="100" /> <Property Name="FieldValue" Type="nvarchar" MaxLength="100" /> <Property Name="DateTimeAdded" Type="datetime" /> <Property Name="OrderReserveNumber" Type="nvarchar" MaxLength="50" /> </EntityType> </Schema> </edmx:StorageModels> <!-- CSDL content --> <edmx:ConceptualModels> <Schema Namespace="MyCocoModel" Alias="Self" p1:UseStrongSpatialTypes="false" xmlns:annotation="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns:p1="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns="http://schemas.microsoft.com/ado/2009/11/edm"> <EntityContainer Name="MyCocoEntities" p1:LazyLoadingEnabled="true"> <EntitySet Name="QcFieldValues" EntityType="MyCocoModel.QcFieldValue" /> </EntityContainer> <EntityType Name="QcFieldValue"> <Key> <PropertyRef Name="ID" /> </Key> <Property Name="ID" Type="Int32" Nullable="false" p1:StoreGeneratedPattern="Identity" /> <Property Name="FieldID" Type="String" MaxLength="100" Unicode="true" FixedLength="false" /> <Property Name="FieldValue" Type="String" MaxLength="100" Unicode="true" FixedLength="false" /> <Property Name="DateTimeAdded" Type="DateTime" Precision="3" /> <Property Name="OrderReserveNumber" Type="String" MaxLength="50" Unicode="true" FixedLength="false" /> </EntityType> </Schema> </edmx:ConceptualModels> <!-- C-S mapping content --> <edmx:Mappings> <Mapping Space="C-S" xmlns="http://schemas.microsoft.com/ado/2009/11/mapping/cs"> <EntityContainerMapping StorageEntityContainer="MyCocoModelStoreContainer" CdmEntityContainer="MyCocoEntities"> <EntitySetMapping Name="QcFieldValues"> <EntityTypeMapping TypeName="MyCocoModel.QcFieldValue"> <MappingFragment StoreEntitySet="QcFieldValues"> <ScalarProperty Name="ID" ColumnName="ID" /> <ScalarProperty Name="FieldID" ColumnName="FieldID" /> <ScalarProperty Name="FieldValue" ColumnName="FieldValue" /> <ScalarProperty Name="DateTimeAdded" ColumnName="DateTimeAdded" /> <ScalarProperty Name="OrderReserveNumber" ColumnName="OrderReserveNumber" /> </MappingFragment> </EntityTypeMapping> </EntitySetMapping> </EntityContainerMapping> </Mapping> </edmx:Mappings> </edmx:Runtime> <!-- EF Designer content (DO NOT EDIT MANUALLY BELOW HERE) --> <Designer xmlns="http://schemas.microsoft.com/ado/2009/11/edmx"> <Connection> <DesignerInfoPropertySet> <DesignerProperty Name="MetadataArtifactProcessing" Value="EmbedInOutputAssembly" /> </DesignerInfoPropertySet> </Connection> <Options> <DesignerInfoPropertySet> <DesignerProperty Name="ValidateOnBuild" Value="true" /> <DesignerProperty Name="EnablePluralization" Value="True" /> <DesignerProperty Name="IncludeForeignKeysInModel" Value="True" /> <DesignerProperty Name="CodeGenerationStrategy" Value="None" /> </DesignerInfoPropertySet> </Options> <!-- Diagram content (shape and connector positions) --> <Diagrams></Diagrams> </Designer> </edmx:Edmx>

    Read the article

  • How to change quicksort to output elements in descending order?

    - by masato-san
    Hi, I wrote a quicksort algorithm however, I would like to make a change somewhere so that this quicksort would output elements in descending order. I searched and found that I can change the comparison operator (<) in partition() to other way around (like below). //This is snippet from partition() function while($array[$l] < $pivot) { $l++; } while($array[$r] > $pivot) { $r--; } But it is not working.. If I quicksort the array below, $array = (3,9,5,7); should be: $array = (9,7,5,3) But actual output is: $array = (3,5,7,9) Below is my quicksort which trying to output elements in descending order. How should I make change to sort in descending order? If you need any clarification please let me know. Thanks! $array = (3,9,5,7); $app = new QuicksortDescending(); $app->quicksort($array, 0, count($array)); print_r($array); class QuicksortDescending { public function partitionDesc(&$array, $left, $right) { $l = $left; $r = $right; $pivot = $array[($right+$left)/2]; while($l <= $r) { while($array[$l] > $pivot) { $l++; } while($array[$r] < $pivot) { $r--; } if($l <= $r) {// if L and R haven't cross $this->swap($array, $l, $r); $l ++; $j --; } } return $l; } public function quicksortDesc(&$array, $left, $right) { $index = $this->partition($array, $left, $right); if($left < $index-1) { //if there is more than 1 element to sort on right subarray $this->quicksortDesc($array, $left, $index-1); } if($index < $right) { //if there is more than 1 element to sort on right subarray $this->quicksortDesc($array, $index, $right); } } }

    Read the article

  • Moving from Windows to Ubuntu.

    - by djzmo
    Hello there, I used to program in Windows with Microsoft Visual C++ and I need to make some of my portable programs (written in portable C++) to be cross-platform, or at least I can release a working version of my program for both Linux and Windows. I am total newcomer in Linux application development (and rarely use the OS itself). So, today, I installed Ubuntu 10.04 LTS (through Wubi) and equipped Code::Blocks with the g++ compiler as my main weapon. Then I compiled my very first Hello World linux program, and I confused about the output program. I can run my program through the "Build and Run" menu option in Code::Blocks, but when I tried to launch the compiled application externally through a File Browser (in /media/MyNTFSPartition/MyProject/bin/Release; yes, I saved it in my NTFS partition), the program didn't show up. Why? I ran out of idea. I need to change my Windows and Microsoft Visual Studio mindset to Linux and Code::Blocks mindset. So I came up with these questions: How can I execute my compiled linux programs externally (outside IDE)? In Windows, I simply run the generated executable (.exe) file How can I distribute my linux application? In Windows, I simply distribute the executable files with the corresponding DLL files (if any) What is the equivalent of LIBs (static library) and DLLs (dynamic library) in linux and how to use them? In Windows/Visual Studio, I simply add the required libraries to the Additional Dependencies in the Project Settings, and my program will automatically link with the required static library(-ies)/DLLs. Is it possible to use the "binary form" of a C++ library (if provided) so that I wouldn't need to recompile the entire library source code? In Windows, yes. Sometimes precompiled *.lib files are provided. If I want to create a wxWidgets application in Linux, which package should I pick for Ubuntu? wxGTK or wxX11? Can I run wxGTK program under X11? In Windows, I use wxMSW, Of course. If question no. 4 is answered possible, are precompiled wxX11/wxGTK library exists out there? Haven't tried deep google search. In Windows, there is a project called "wxPack" (http://wxpack.sourceforge.net/) that saves a lot of my time. Sorry for asking many questions, but I am really confused on these linux development fundamentals. Any kind of help would be appreciated =) Thanks.

    Read the article

  • Database file is inexplicably locked during SQLite commit

    - by sweeney
    Hello, I'm performing a large number of INSERTS to a SQLite database. I'm using just one thread. I batch the writes to improve performance and have a bit of security in case of a crash. Basically I cache up a bunch of data in memory and then when I deem appropriate, I loop over all of that data and perform the INSERTS. The code for this is shown below: public void Commit() { using (SQLiteConnection conn = new SQLiteConnection(this.connString)) { conn.Open(); using (SQLiteTransaction trans = conn.BeginTransaction()) { using (SQLiteCommand command = conn.CreateCommand()) { command.CommandText = "INSERT OR IGNORE INTO [MY_TABLE] (col1, col2) VALUES (?,?)"; command.Parameters.Add(this.col1Param); command.Parameters.Add(this.col2Param); foreach (Data o in this.dataTemp) { this.col1Param.Value = o.Col1Prop; this. col2Param.Value = o.Col2Prop; command.ExecuteNonQuery(); } } this.TryHandleCommit(trans); } conn.Close(); } } I now employ the following gimmick to get the thing to eventually work: private void TryHandleCommit(SQLiteTransaction trans) { try { trans.Commit(); } catch (Exception e) { Console.WriteLine("Trying again..."); this.TryHandleCommit(trans); } } I create my DB like so: public DataBase(String path) { //build connection string SQLiteConnectionStringBuilder connString = new SQLiteConnectionStringBuilder(); connString.DataSource = path; connString.Version = 3; connString.DefaultTimeout = 5; connString.JournalMode = SQLiteJournalModeEnum.Persist; connString.UseUTF16Encoding = true; using (connection = new SQLiteConnection(connString.ToString())) { //check for existence of db FileInfo f = new FileInfo(path); if (!f.Exists) //build new blank db { SQLiteConnection.CreateFile(path); connection.Open(); using (SQLiteTransaction trans = connection.BeginTransaction()) { using (SQLiteCommand command = connection.CreateCommand()) { command.CommandText = DataBase.CREATE_MATCHES; command.ExecuteNonQuery(); command.CommandText = DataBase.CREATE_STRING_DATA; command.ExecuteNonQuery(); //TODO add logging } trans.Commit(); } connection.Close(); } } } I then export the connection string and use it to obtain new connections in different parts of the program. At seemingly random intervals, though at far too great a rate to ignore or otherwise workaround this problem, I get unhandled SQLiteException: Database file is locked. This occurs when I attempt to commit the transaction. No errors seem to occur prior to then. This does not always happen. Sometimes the whole thing runs without a hitch. No reads are being performed on these files before the commits finish. I have the very latest SQLite binary. I'm compiling for .NET 2.0. I'm using VS 2008. The db is a local file. All of this activity is encapsulated within one thread / process. Virus protection is off (though I think that was only relevant if you were connecting over a network?). As per Scotsman's post I have implemented the following changes: Journal Mode set to Persist DB files stored in C:\Docs + Settings\ApplicationData via System.Windows.Forms.Application.AppData windows call No inner exception Witnessed on two distinct machines (albeit very similar hardware and software) Have been running Process Monitor - no extraneous processes are attaching themselves to the DB files - the problem is definitely in my code... Does anyone have any idea whats going on here? I know I just dropped a whole mess of code, but I've been trying to figure this out for way too long. My thanks to anyone who makes it to the end of this question! brian UPDATES: Thanks for the suggestions so far! I've implemented many of the suggested changes. I feel that we are getting closer to the answer...however... The code above technically works however it is non-deterministic! It is not guaranteed to do anything aside from spin in neutral forever. In practice it seems to work somewhere between the 1st and 10th iteration. If i batch my commits at a reasonable interval damage will be mitigated but I really do not want to leave things in this state... More suggestions welcome!

    Read the article

  • CMake: Mac OS X: ld: unknown option: -soname

    - by Alex Ivasyuv
    I try to build my app with CMake on Mac OS X, I get the following error: Linking CXX shared library libsml.so ld: unknown option: -soname collect2: ld returned 1 exit status make[2]: *** [libsml.so] Error 1 make[1]: *** [CMakeFiles/sml.dir/all] Error 2 make: *** [all] Error 2 This is strange, as Mac has .dylib extension instead of .so. There's my CMakeLists.txt: cmake_minimum_required(VERSION 2.6) PROJECT (SilentMedia) SET(SourcePath src/libsml) IF (DEFINED OSS) SET(OSS_src ${SourcePath}/Media/Audio/SoundSystem/OSS/DSP/DSP.cpp ${SourcePath}/Media/Audio/SoundSystem/OSS/Mixer/Mixer.cpp ) ENDIF(DEFINED OSS) IF (DEFINED ALSA) SET(ALSA_src ${SourcePath}/Media/Audio/SoundSystem/ALSA/DSP/DSP.cpp ${SourcePath}/Media/Audio/SoundSystem/ALSA/Mixer/Mixer.cpp ) ENDIF(DEFINED ALSA) SET(SilentMedia_src ${SourcePath}/Utils/Base64/Base64.cpp ${SourcePath}/Utils/String/String.cpp ${SourcePath}/Utils/Random/Random.cpp ${SourcePath}/Media/Container/FileLoader.cpp ${SourcePath}/Media/Container/OGG/OGG.cpp ${SourcePath}/Media/PlayList/XSPF/XSPF.cpp ${SourcePath}/Media/PlayList/XSPF/libXSPF.cpp ${SourcePath}/Media/PlayList/PlayList.cpp ${OSS_src} ${ALSA_src} ${SourcePath}/Media/Audio/Audio.cpp ${SourcePath}/Media/Audio/AudioInfo.cpp ${SourcePath}/Media/Audio/AudioProxy.cpp ${SourcePath}/Media/Audio/SoundSystem/SoundSystem.cpp ${SourcePath}/Media/Audio/SoundSystem/libao/AO.cpp ${SourcePath}/Media/Audio/Codec/WAV/WAV.cpp ${SourcePath}/Media/Audio/Codec/Vorbis/Vorbis.cpp ${SourcePath}/Media/Audio/Codec/WavPack/WavPack.cpp ${SourcePath}/Media/Audio/Codec/FLAC/FLAC.cpp ) SET(SilentMedia_LINKED_LIBRARY sml vorbisfile FLAC++ wavpack ao #asound boost_thread-mt boost_filesystem-mt xspf gtest ) INCLUDE_DIRECTORIES( /usr/include /usr/local/include /usr/include/c++/4.4 /Users/alex/Downloads/boost_1_45_0 ${SilentMedia_SOURCE_DIR}/src ${SilentMedia_SOURCE_DIR}/${SourcePath} ) #link_directories( # /usr/lib # /usr/local/lib # /Users/alex/Downloads/boost_1_45_0/stage/lib #) IF(LibraryType STREQUAL "static") ADD_LIBRARY(sml-static STATIC ${SilentMedia_src}) # rename library from libsml-static.a => libsml.a SET_TARGET_PROPERTIES(sml-static PROPERTIES OUTPUT_NAME "sml") SET_TARGET_PROPERTIES(sml-static PROPERTIES CLEAN_DIRECT_OUTPUT 1) ELSEIF(LibraryType STREQUAL "shared") ADD_LIBRARY(sml SHARED ${SilentMedia_src}) # change compile optimization/debug flags # -Werror -pedantic IF(BuildType STREQUAL "Debug") SET_TARGET_PROPERTIES(sml PROPERTIES COMPILE_FLAGS "-pipe -Wall -W -ggdb") ELSEIF(BuildType STREQUAL "Release") SET_TARGET_PROPERTIES(sml PROPERTIES COMPILE_FLAGS "-pipe -Wall -W -O3 -fomit-frame-pointer") ENDIF() SET_TARGET_PROPERTIES(sml PROPERTIES CLEAN_DIRECT_OUTPUT 1) ENDIF() ### TEST ### IF(Test STREQUAL "true") ADD_EXECUTABLE (bin/TestXSPF ${SourcePath}/Test/Media/PlayLists/XSPF/TestXSPF.cpp) TARGET_LINK_LIBRARIES (bin/TestXSPF ${SilentMedia_LINKED_LIBRARY}) ADD_EXECUTABLE (bin/test1 ${SourcePath}/Test/test.cpp) TARGET_LINK_LIBRARIES (bin/test1 ${SilentMedia_LINKED_LIBRARY}) ADD_EXECUTABLE (bin/TestFileLoader ${SourcePath}/Test/Media/Container/FileLoader/TestFileLoader.cpp) TARGET_LINK_LIBRARIES (bin/TestFileLoader ${SilentMedia_LINKED_LIBRARY}) ADD_EXECUTABLE (bin/testMixer ${SourcePath}/Test/testMixer.cpp) TARGET_LINK_LIBRARIES (bin/testMixer ${SilentMedia_LINKED_LIBRARY}) ENDIF (Test STREQUAL "true") ### TEST ### ADD_CUSTOM_TARGET(doc COMMAND doxygen ${SilentMedia_SOURCE_DIR}/doc/Doxyfile) There was no error on Linux. Build process: cmake -D BuildType=Debug -D LibraryType=shared . make I found, that incorrect command generate in CMakeFiles/sml.dir/link.txt. But why, as the goal of CMake is cross-platforming.. How to fix it?

    Read the article

  • How to perform duplicate key validation using entlib (or DataAnnotations), MVC, and Repository pattern

    - by olivehour
    I have a set of ASP.NET 4 projects that culminate in an MVC (3 RC2) app. The solution uses Unity and EntLib Validation for cross-cutting dependency injection and validation. Both are working great for injecting repository and service layer implementations. However, I can't figure out how to do duplicate key validation. For example, when a user registers, we want to make sure they don't pick a UserID that someone else is already using. For this type of validation, the validating object must have a repository reference... or some other way to get an IQueryable / IEnumerable reference to check against other rows already in the DB. What I have is a UserMetadata class that has all of the property setters and getters for a user, along with all of the appropriate DataAnnotations and EntLib Validation attributes. There is also a UserEntity class implemented using EF4 POCO Entity Generator templates. The UserEntity depends on UserMetadata, because it has a MetadataTypeAttribute. I also have a UserViewModel class that has the same exact MetadataType attribute. This way, I can apply the same validation rules, via attributes, to both the entity and viewmodel. There are no concrete references to the Repository classes whatsoever. All repositories are injected using Unity. There is also a service layer that gets dependency injection. In the MVC project, service layer implementation classes are injected into the Controller classes (the controller classes only contain service layer interface references). Unity then injects the Repository implementations into the service layer classes (service classes also only contain interface references). I've experimented with the DataAnnotations CustomValidationAttribute in the metadata class. The problem with this is the validation method must be static, and the method cannot instantiate a repository implementation directly. My repository interface is IRepository, and I have only one single repository implementation class defined as EntityRepository for all domain objects. To instantiate a repository explicitly I would need to say new EntityRepository(), which would result in a circular dependency graph: UserMetadata [depends on] DuplicateUserIDValidator [depends on] UserEntity [depends on] UserMetadata. I've also tried creating a custom EntLib Validator along with a custom validation attribute. Here I don't have the same problem with a static method. I think I could get this to work if I could just figure out how to make Unity inject my EntityRepository into the validator class... which I can't. Right now, all of the validation code is in my Metadata class library, since that's where the custom validation attribute would go. Any ideas on how to perform validations that need to check against the current repository state? Can Unity be used to inject a dependency into a lower-layer class library?

    Read the article

  • Javascript self contained sandbox events and client side stack

    - by amnon
    I'm in the process of moving a JSF heavy web application to a REST and mainly JS module application . I've watched "scalable javascript application architecture" by Nicholas Zakas on yui theater (excellent video) and implemented much of the talk with good success but i have some questions : I found the lecture a little confusing in regards to the relationship between modules and sandboxes , on one had to my understanding modules should not be effected by something happening outside of their sandbox and this is why they publish events via the sandbox (and not via the core as they do access the core for hiding base libary) but each module in the application gets a new sandbox ? , shouldn't the sandbox limit events to the modoules using it ? or should events be published cross page ? e.g. : if i have two editable tables but i want to contain each one in a different sandbox and it's events effect only the modules inside that sandbox something like messabe box per table which is a different module/widget how can i do that with sandbox per module , ofcourse i can prefix the events with the moduleid but that creates coupling that i want to avoid ... and i don't want to package modules toghter as one module per combination as i already have 6-7 modules ? while i can hide the base library for small things like id selector etc.. i would still like to use the base library for module dependencies and resource loading and use something like yui loader or dojo.require so in fact i'm hiding the base library but the modules themself are defined and loaded by the base library ... seems a little strange to me libraries don't return simple js objects but usualy wrap them e.g. : u can do something like $$('.classname').each(.. which cleans the code alot , it makes no sense to wrap the base and then in the module create a dependency for the base library by executing .each but not using those features makes a lot of code written which can be left out ... and implemnting that functionality is very bug prone does anyonen have any experience with building a front side stack of this order ? how easy is it to change a base library and/or have modules from different libraries , using yui datatable but doing form validation with dojo ... ? some what of a combination of 2+4 if u choose to do something like i said and load dojo form validation widgets for inputs via yui loader would that mean dojocore is a module and the form module is dependant on it ? Thanks .

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • Primary language - C++/Qt, C#, Java?

    - by Airjoe
    I'm looking for some input, but let me start with a bit of background (for tl;dr skip to end). I'm an IT major with a concentration in networking. While I'm not a CS major nor do I want to program as a vocation, I do consider myself a programmer and do pretty well with the concepts involved. I've been programming since about 6th grade, started out with a proprietary game creation language that made my transition into C++ at college pretty easy. I like to make programs for myself and friends, and have been paid to program for local businesses. A bit about that- I wrote some programs for a couple local businesses in my senior year in high school. I wrote management systems for local shops (inventory, phone/pos orders, timeclock, customer info, and more stuff I can't remember). It definitely turned out to be over my head, as I had never had any formal programming education. It was a great learning experience, but damn was it crappy code. Oh yeah, by the way, it was all vb6. So, I've used vb6 pretty extensively, I've used c++ in my classes (intro to programming up to algorithms), used Java a little bit in another class (had to write a ping client program, pretty easy) and used Java for some simple Project Euler problems to help learn syntax and such when writing the program for the class. I've also used C# a bit for my own simple personal projects (simple programs, one which would just generate an HTTP request on a list of websites and notify if one responded unexpectedly or not at all, and another which just held a list of things to do and periodically reminded me to do them), things I would've written in vb6 a year or two ago. I've just started using Qt C++ for some undergrad research I'm working on. Now I've had some formal education, I [think I] understand organization in programming a lot better (I didn't even use classes in my vb6 programs where I really should have), how it's important to structure code, split into functions where appropriate, document properly, efficiency both in memory and speed, dynamic and modular programming etc. I was looking for some input on which language to pick up as my "primary". As I'm not a "real programmer", it will be mostly hobby projects, but will include some 'real' projects I'm sure. From my perspective: QtC++ and Java are cross platform, which is cool. Java and C# run in a virtual machine, but I'm not sure if that's a big deal (something extra to distribute, possibly a bit slower? I think Qt would require additional distributables too, right?). I don't really know too much more than this, so I appreciate any help, thanks! TL;DR Am an avocational programmer looking for a language, want quick and straight forward development, liked vb6, will be working with database driven GUI apps- should I go with QtC++, Java, C#, or perhaps something else?

    Read the article

  • MATLAB image corner coordinates & referncing to cell arrays

    - by James
    Hi, I am having some problems comparing the elements in different cell arrays. The context of this problem is that I am using the bwboundaries function in MATLAB to trace the outline of an image. The image is of a structural cross section and I am trying to find if there is continuity throughout the section (i.e. there is only one outline produced by the bwboundaries command). Having done this and found where the is more than one section traced (i.e. it is not continuous), I have used the cornermetric command to find the corners of each section. The code I have is: %% Define the structural section as a binary matrix (Image is an I-section with the web broken) bw(20:40,50:150) = 1; bw(160:180,50:150) = 1; bw(20:60,95:105) = 1; bw(140:180,95:105) = 1; Trace = bw; [B] = bwboundaries(Trace,'noholes'); %Traces the outer boundary of each section L = length(B); % Finds number of boundaries if L > 1 disp('Multiple boundaries') % States whether more than one boundary found end %% Obtain perimeter coordinates for k=1:length(B) %For all the boundaries perim = B{k}; %Obtains perimeter coordinates (as a 2D matrix) from the cell array end %% Find the corner positions C = cornermetric(bw); Areacorners = find(C == max(max(C))) % Finds the corner coordinates of each boundary [rowindexcorners,colindexcorners] = ind2sub(size(Newgeometry),Areacorners) % Convert corner coordinate indexes into subcripts, to give x & y coordinates (i.e. the same format as B gives) %% Put these corner coordinates into a cell array Cornerscellarray = cell(length(rowindexcorners),1); % Initialises cell array of zeros for i =1:numel(rowindexcorners) Cornerscellarray(i) = {[rowindexcorners(i) colindexcorners(i)]}; %Assigns the corner indicies into the cell array %This is done so the cell arrays can be compared end for k=1:length(B) %For all the boundaries found perim = B{k}; %Obtains coordinates for each perimeter Z = perim; % Initialise the matrix containing the perimeter corners Sectioncellmatrix = cell(length(rowindexcorners),1); for i =1:length(perim) Sectioncellmatrix(i) = {[perim(i,1) perim(i,2)]}; end for i = 1:length(perim) if Sectioncellmatrix(i) ~= Cornerscellarray Sectioncellmatrix(i) = []; %Gets rid of the elements that are not corners, but keeps them associated with the relevent section end end end This creates an error in the last for loop. Is there a way I can check whether each cell of the array (containing an x and y coordinate) is equal to any pair of coordinates in cornercellarray? I know it is possible with matrices to compare whether a certain element matches any of the elements in another matrix. I want to be able to do the same here, but for the pair of coordinates within the cell array. The reason I don't just use the cornercellarray cell array itself, is because this lists all the corner coordinates and does not associate them with a specific traced boundary.

    Read the article

  • Windows API Programing....

    - by vs4vijay
    Hello There... Its me Vijay.. I m Trying to make a CrossHair(some kind of cursor) On The Screen while running a Game (Counter Strike)... so i did this... ############################# #include<iostream.h> #include<windows.h> #include<conio.h> #include<dos.h> #include<stdlib.h> #include<process.h> #include <time.h> int main() { HANDLE hl = OpenProcess(PROCESS_ALL_ACCESS,TRUE,pid); // Here pid is the process ID of the Game... HDC hDC = GetDC(NULL); //Here i pass NULL for Entire Screen... HBRUSH hb=CreateSolidBrush(RGB(0,255,255)); SelectObject(hDC,hb); POINT p; while(!kbhit()) { int x=1360/2,y=768/2; MoveToEx(hDC,x-20,y,&p); LineTo(hDC,x+20,y); SetPixel(hDC,x,y,RGB(255,0,0)); SetPixel(hDC,x-1,y-1,RGB(255,0,0)); SetPixel(hDC,x-1,y+1,RGB(255,0,0)); SetPixel(hDC,x+1,y+1,RGB(255,0,0)); SetPixel(hDC,x+1,y-1,RGB(255,0,0)); MoveToEx(hDC,x,y-20,&p); LineTo(hDC,x,y+20); } cin.get(); return 0; } #################################### it works fine....at desktop i see crosshair...but my problem is that when i run game...the cross here got disappeared.... so i think i did not handle the process of game... so i pass the HANDLE to the GetDC(hl)... But GetDC take only HWND(Handle To Window)... so i typecast it like this... HWND hl = (HWND)OpenProcess(PROCESS_ALL_ACCESS,TRUE,pid); and passed hl to the GetDC(hl)... but it doesnt work...Whats wrong with the code... plz tell me how do i make a simple shape at the screen on a process or game... PS : (My Compiler Is DevCPP and OS WinXP SP3....)

    Read the article

< Previous Page | 205 206 207 208 209 210 211 212 213 214 215 216  | Next Page >