Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 225/344 | < Previous Page | 221 222 223 224 225 226 227 228 229 230 231 232  | Next Page >

  • Storing links to internal content pages in ASP.NET MVC

    - by mare
    I'm using a route like this routes.MapRoute( "PageBySlug", RouteType.Regular, "{slug}", new {controller = "Page", action = "Display", slug = "Default"}, null ); to map request to ~/Some-Page-Slug to ~/Page/Display/Some-Page-Slug. When adding content, user can choose to link to existing pages to create references and I then store those links in this format in the datastore: "/Some-Page-Slug". When I run the app in Cassini and pull the link out from datastore and attach it to A tag it looks like this http://localhost:93229/Some-Page-Slug and this link works. But when running the application in virtual directory under some website in IIS, the attached link generates this URL http://localhost/Some-Page-Slug, when it should be http://localhost/virtualdir/Some-Page-Slug. Of course, this generates 404 error. How can I solve this to be universally useful and working under all circumstances? Should I store it differently in the database or should I transform it into correct form in my Views at runtime and how to do that?

    Read the article

  • Handling Special char such as ^ÛY, ^ÛR in java

    - by RJ
    Hi, Has anybody encountered special char such as ^ÛY, ^ÛR ? Q1. How do I do an ftp of the files containing these chars? The chars are not seen once I do a ftp on AIX (bi or ascii) and hence I am unable to see my program to replace these, working. Q2. My java program doesn't seem to recognise these or replace these if I search for these explicitly (^ÛY, ^ÛR ) in the file however a replace using regular expression seems to work (I could only see the difference in the length of the string). My program is executed on AIX. Any insights why java cannot recognise these? Q3. Does the Oracle database recognise these chars? An update is failing where my program indicates the string to be of lesser length and without these characters but the db complains "value too large for column" as the string to be updated contains these chars and hence longer. thanks in advance, RJ

    Read the article

  • Regex to validate SMTP Responses?

    - by Alix Axel
    I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

    Read the article

  • Mirror a git repository by pulling?

    - by corydoras
    I am wondering if there is an easy way, ie like a simple cron job, to regularly pull from a remote git repository to a local read only mirror for backup purposes? Ideally it would pull all branches and tags, but the master/trunk/head would be sufficient. I just need a way to make sure that if the master git server dies, we have a backup location that we could manually fail over to. (I have been googling and reading documentation for help on how to do this for quite some time now and the furthest I have gotten is a bash script that does pull's on a regular interval.)

    Read the article

  • How do you authenticate user generated "apps" for your app?

    - by Brian Armstrong
    I'm think something like Facebook apps here. User generated pieces of code that people can write to interact with my app. I understand how an authenticated API works, but this seems a little more complicated because not only does the APP have to authenticate itself (with a regular api-key) but the USER using the app has to be authenticated somehow too, without giving the app free reign. I've been reading a bit here to see how FB does it: http://wiki.developers.facebook.com/index.php/How_Facebook_Authenticates_Your_Application And it looks like you have to pass a signature in addition to the api-key along with every call, but I'm having trouble wrapping my head around how this gets generated and used on the other end (my server). Figure there must be a simple explanation of this out there? Thanks! P.S. I'm building a Rails app if there are any applicable gems/plugins.

    Read the article

  • Java RandomAccessFile - dealing with different newline styles?

    - by waitinforatrain
    Hey, I'm trying to seek through a RandomAccessFile, and as part of an algorithm I have to read a line, and then seek backwards from the end of the line E.g String line = raf.readLine(); raf.seek (raf.getFilePointer() - line.length() + m.start() + m.group().length()); //m is a Matcher for regular expressions I've been getting loads of off-by-one errors and couldn't figure out why. I just discovered it's because some files I'm reading from have UNIX-style linefeeds, \r\n, and some have just windows-style \n. Is there an easy to have the RandomAccessFile treat all linefeeds as windows-style linefeeds?

    Read the article

  • [AS3] htmlText not showing bold or italics font

    - by Conor
    So I have a MovieClip asset with a dynamic textfield sitting inside of it. I export my .fla as a .swc to use within Flash Builder 4, and create instances of the asset with code, populating the text dynamically from XML. My issue is that even though I have htmlText enabled, bold and italics tags don't appear to be working. I have a feeling it is because when I created the asset in Flash CS4, the text field makes you specify the font, and the subset of that to use (Regular, Bold, Oblique, etc). Is there any way to get the htmlText to render bold and italics tags properly without having to completely rethink the way I'm creating all these fields?

    Read the article

  • How do I adjust overall width of rdlc report when some columns are hidden?

    - by user115487
    I have a customizable rdlc report where the user can choose which columns to show. All the columns are included in the report designer, and I use parameters to hide/show columns based on the user's choice. The report renders correctly, and only shows the selected columns, HOWEVER, the overall width of the report is the same as if all the columns were visible. This means that the report can have a huge empty area to the right of the selected columns, which looks very silly. So my question: Is there a way to adjust the report width dynamically at runtime to avoid a large silly empty area in the report? I attempted to do this in the designer by assigning a parameter to the width of the report body....but that was not allowed. The width cannot be an expression of any kind in the designer, only an actual value is allowed. Any suggestions?

    Read the article

  • PostgreSQL 8.3 data types: xml vs varchar

    - by Sejanus
    There's xml data type in Postgres, I never used it before so I'd like to hear opinions. Downsides and upsides vs using regular varchar (or Text) column to store xml. The text I'm going to store is xml, well-formed, UTF-8. No need to search by it (I've read searching by xml is slow). This XML actually is data prepared for PDF generation with Apache FOP. XML can be generated dynamically from data found elsewhere (other Postgres tables), it's stored as is only so that I won't need to generate it twice. Kinda backup#2 for already generated PDF documents. Anything else to know? Good practices, performance, maintenance, etc?

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • How to calculate unbound column value based on value of bound colum in DatagGridView?

    - by Wodzu
    Hi. I have few columns in my DataGridView, one of them is an unbound column and the DataGridVIew is in VirtualMode. When CellValueNeeded event is called, I want to calculate value of Cells[0] basing on the value of Cells[2] which is in bounded column to the underlaying DataSource. This is how I try to do this: private void dgvItems_CellValueNeeded(object sender, DataGridViewCellValueEventArgs e) { e.Value = dgvItems.CurrentRow.Cells[2].Value * 5; //simplified example } However, I am getting System.StackOverflowException because it seams that call to dgvItems.CurrentRow.Cells[2].Value results in call to another CellValueNeeded event. And so on and so on... However Cells[2] is not an unbound column, so on common sense it should not result in recursive call unless getting value of any column(bound or unbound) firest that event... I can not use here SQL Expression and I can not precalculate e.Value in any SQL call. In real example Cells[2].Value is a key used in HashTable which will return a correct value for the Cells[0] (e.Value). What can I do?

    Read the article

  • Flash AS3 and XML: way to fix line breaks in htmlText that uses <b> tags in the xml?

    - by HeroicNate
    I'm importing text in from an xml file and i'm using htmlText to try to keep some styling with tags. I have both the regular and bold face font embedded, and the bolding works fine. The problem is that it ads spaces around the words in bold like a paragraph indent and then makes a line-break after them. What's going on, is there a way to fix? fromxmlText.htmlText = theXML.contenttext; If I pull the text in from a txt file it will work fine, but taking it out of an xml file causing funky formatting. lil' help?

    Read the article

  • Theory of computation - Using the pumping lemma for context free languages

    - by Tony
    I'm reviewing my notes for my course on theory of computation and I'm having trouble understanding how to complete a certain proof. Here is the question: A = {0^n 1^m 0^n | n>=1, m>=1} Prove that A is not regular. It's pretty obvious that the pumping lemma has to be used for this. So, we have |vy| = 1 |vxy| <= p (p being the pumping length, = 1) uv^ixy^iz exists in A for all i = 0 Trying to think of the correct string to choose seems a bit iffy for this. I was thinking 0^p 1^q 0^p, but I don't know if I can obscurely make a q, and since there is no bound on u, this could make things unruly.. So, how would one go about this?

    Read the article

  • SSRS: Report label position dynamic

    - by Nauman
    I have a report which displays customer address in multiple labels. My customers use windowed envelopes for mailing. I need the address labels position to be configurable. Something like, I'll have a database table which stores the Top/Left position of each label per customer. Based on this table, I need to position the address labels on my report. I thought, it is doable by expressions, but Location property doesn't provides ability to set an expression and make the label's top and left dynamic. Anybody, any ideas, on how to achieve this?

    Read the article

  • ASP.NET GridView sorting on method data

    - by husainnz
    Hi, I'm binding a GridView to a domain model object, this domain model object has a method for working out a formatted value to display on the grid. I'd like to use this method for my display value, which is fine, but I'd also like to be able to sort on the value returned by that method. My sort expression can only take in a property/field at the moment. Help please! What do I need to do to get this to work? I'm using an SPGridView actually, but that doesn't make a lot of difference to my problem. Thanks.

    Read the article

  • 503 (Server Unavailable) WebException when loading local XHTML file

    - by kcoppock
    Hello! So I'm currently working on an ePub reader application, and I've been reading through a bunch of regular XML files just fine with System.Xml and XmlDocument: XmlDocument xmldoc = new XmlDocument(); xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "META-INF/container.xml")); XmlNodeList xnl = xmldoc.GetElementsByTagName("rootfile"); However, now I'm trying to open the XHTML files that contain the actual book text, and they're XHTML files. Now I don't really know the difference between the two, but I'm getting the following error with this code (in the same document, using the same XmlDocument and XmlNodeList variable) xmldoc.Load(Path.Combine(Directory.GetCurrentDirectory(), "OEBPS/part1.xhtml")); "WebException was unhandled: The remote server returned an error: (503) Server Unavailable" It's a local document, so I'm not understanding why it's giving this error? Any help would be greatly appreciated. :) I've got the full source code here if it helps: http://drop.io/epubtest (I know the ePubConstructor.ParseDocument() method is horribly messy, I'm just trying to get it working at the moment before I split it into classes)

    Read the article

  • Visual Studio confused by server code inside javascript

    - by Felix
    I ran into an annoying problem: the following code gives a warning in Visual Studio. <script type="text/javascript"> var x = <%: ViewData["param"] %>; </script> The warning is "Expected expression". Visual Studion gets confused, and all the javascript code after that is giving tons of warnings. Granted, it's all warnings, and it works perfectly fine in runtime - but it is very easy to miss real warnings among dozen of false positives. It was working the same way in VS2008, and it wasn't fixed in VS2010. Does anybody know if there is a workaround, or a patch?

    Read the article

  • iphone - passing an object on an UIToolbarButton action

    - by Mike
    Is that possible to make a UIToolbarButton pass an object to its target by using some exoteric method (as it seems not to be possible using regular button use)? I mean something like UIBarButtonItem *Button = [[UIBarButtonItem alloc] initWithImage:buttonImage style:UIBarButtonItemStylePlain target:self action:@selector(doSomething:) **withObject:usingThis**]; I know I can trigger a method that will launch the full method with the object, but for the sake of elegance I was trying to minimize the code... I suspect it is not possible, but as you guys out there are insanely good you may come with an transcendental answer... who knows...

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Wpf- Is there any way to disable some of the default hotkeys in a RichTextBox?

    - by Justin
    I have several keybindings in my text editing application that no longer work now that I have switched from using a regular textbox to using a richtextbox. This is because the wpf richtextbox has several default hokeys such as "Ctrl+1", "Ctrl+2", and "Ctrl+5". My keybindings are defined in a view that contains the view that the richtextbox is in. I can't move the keybindings to the richtextbox; Is there any fix for this problem? Other than using a third-party control or creating my own richtextbox from textboxbase.

    Read the article

  • How do you protect code from leaking outside?

    - by cubex
    Besides open-sourcing your project and legislation, are there ways to prevent, or at least minimize the damages of code leaking outside your company/group? We obviously can't block Internet access (to prevent emailing the code) because programmer's need their references. We also can't block peripheral devices (USB, Firewire, etc.) The code matters most when it has some proprietary algorithms and in-house developed knowledge (as opposed to regular routine code to draw GUIs, connect to databases, etc.), but some applications (like accounting software and CRMs) are just that: complex collections of routine code that are simple to develop in principle, but will take years to write from scratch. This is where leaked code will come in handy to competitors. As far as I see it, preventing leakage relies almost entirely on human process. What do you think? What precautions and measures are you taking? And has code leakage affected you before?

    Read the article

  • C# Threads.Abort()

    - by Betamoo
    If a thread is running a function func1 that calls another function func2 inside it... Then I called thread.Abort() Will this stop func1 only OR func1 and func2 and all the functions func1 has called?? Thanks Edit: Here are more detail: func1 is called in a new thread, it continuously calls func2 on regular basis... func2 begin doing some work only if some array is not null.. it finishes it and return When supervisor wants to save data, it aborts Thread of func1- and then makes array null, saves data, then fill in the array with new one.. and starts Thread with func1 again.. Sometimes exception is raised because array is null in func2.. so func1 abort did not affect func2

    Read the article

  • Best way to parse command line arguments in C#

    - by Paul Stovell
    When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 221 222 223 224 225 226 227 228 229 230 231 232  | Next Page >