Search Results

Search found 71879 results on 2876 pages for 'file handling'.

Page 23/2876 | < Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Handling EJB/JPA exceptions in a “beautiful” way

    - by Rodrigues, Raphael
    In order to handle JPA exceptions, there are some ways already detailed in lots of blogs. Here, I intend to show one of them, which I consider kind of “beauty”. My use case has a unique constraint, when the User try to create a duplicate value in database. The JPA throws a java.sql.SQLIntegrityConstraintViolationException, and I have to catch it and replace the message. In fact, ADF Business Components framework already has a beautiful solution for this very well documented here . However, for EJB/JPA there's no similar approach. In my case, what I had to do was: 1. Create a custom Error Handler Class in DataBindings file; a. Here is how you accomplish it. 2. Override the reportException method and check if the type of exception exists on property file a. If yes, I change the message and rethrows the exception b. If not, go on the execution The main goal of this approach is whether a new or unhandled Exception was raised, the job is, only create a single entry in bundle property file. Here are pictures step by step: 1. CustomExceptionHandler.java 2. Databindings.cpx 3. Bundle file 4. jspx: 5. Stacktrace: Give your opinion, what did you think about that?

    Read the article

  • Any good reason open files in text mode?

    - by Tinctorius
    (Almost-)POSIX-compliant operating systems and Windows are known to distinguish between 'binary mode' and 'text mode' file I/O. While the former mode doesn't transform any data between the actual file or stream and the application, the latter 'translates' the contents to some standard format in a platform-specific manner: line endings are transparently translated to '\n' in C, and some platforms (CP/M, DOS and Windows) cut off a file when a byte with value 0x1A is found. These transformations seem a little useless to me. People share files between computers with different operating systems. Text mode would cause some data to be handled differently across some platforms, so when this matters, one would probably use binary mode instead. As an example: while Windows uses the sequence CR LF to end a line in text mode, UNIX text mode will not treat CR as part of the line ending sequence. Applications would have to filter that noise themselves. Older Mac versions only use CR in text mode as line endings, so neither UNIX nor Windows would understand its files. If this matters, a portable application would probably implement the parsing by itself instead of using text mode. Implementing newline interpretation in the parser might also remove some overhead of using text mode, as buffers would need to be rewritten (and possibly resized) before returning to the application, while this may be less efficient than when it would happen in the application instead. So, my question is: is there any good reason to still rely on the host OS to translate line endings and file truncation?

    Read the article

  • Packing up files on my machine, sending it to a server, and unpacking it

    - by MxyL
    I am implementing a feature in my application that sends all files in a specified folder to a server. I have the basic FTP transaction set up using Apache Commons FTPClient: it sets up a connection and transfers a file from one place to another. So I can simply loop over the directory and use this connection to transfer all the files. However, this could be better. Rather than transferring each file one by one, it makes more sense to pack it up in a compressed archive and then send the whole file at once. Saves time and bandwidth, since these are just text files so they compress nicely. So I would like to add automatic archive packing and unpacking. This is the workflow I have planned out, using zip compression: Zip all files in the folder Send the file over Unzip the files at its destination 1 and 2 are easy since the files are on the local machine, but I'm not sure how to accomplish the last step, when the files are now on a remote server. What are my options? I have control over what I can put and run on the server. Perhaps it is not necessary to do the packing/unpacking myself?

    Read the article

  • Any good reason to open files in text mode?

    - by Tinctorius
    (Almost-)POSIX-compliant operating systems and Windows are known to distinguish between 'binary mode' and 'text mode' file I/O. While the former mode doesn't transform any data between the actual file or stream and the application, the latter 'translates' the contents to some standard format in a platform-specific manner: line endings are transparently translated to '\n' in C, and some platforms (CP/M, DOS and Windows) cut off a file when a byte with value 0x1A is found. These transformations seem a little useless to me. People share files between computers with different operating systems. Text mode would cause some data to be handled differently across some platforms, so when this matters, one would probably use binary mode instead. As an example: while Windows uses the sequence CR LF to end a line in text mode, UNIX text mode will not treat CR as part of the line ending sequence. Applications would have to filter that noise themselves. Older Mac versions only use CR in text mode as line endings, so neither UNIX nor Windows would understand its files. If this matters, a portable application would probably implement the parsing by itself instead of using text mode. Implementing newline interpretation in the parser might also remove some overhead of using text mode, as buffers would need to be rewritten (and possibly resized) before returning to the application, while this may be less efficient than when it would happen in the application instead. So, my question is: is there any good reason to still rely on the host OS to translate line endings and file truncation?

    Read the article

  • Handling HumanTask attachments in Oracle BPM 11g PS4FP+ (I)

    - by ccasares
    Adding attachments to a HumanTask is a feature that exists in Oracle HWF (Human Workflow) since 10g. However, in 11g there have been many improvements on this feature and this entry will try to summarize them. Oracle BPM 11g 11.1.1.5.1 (aka PS4 Feature Pack or PS4FP) introduced two great features: Ability to link attachments at a Task scope or at a Process scope: "Task" attachments are only visible within the scope (lifetime) of a task. This means that, initially, any member of the assignment pattern of the Human Task will be able to handle (add, review or remove) attachments. However, once the task is completed, subsequent human tasks will not have access to them. This does not mean those attachments got lost. Once the human task is completed, attachments can be retrieved in order to, i.e., check them in to a Content Server or to inject them to a new and different human task. Aside note: a "re-initiated" human task will inherit comments and attachments, along with history and -optionally- payload. See here for more info. "Process" attachments are visible within the scope of the process. This means that subsequent human tasks in the same process instance will have access to them. Ability to use Oracle WebCenter Content (previously known as "Oracle UCM") as the backend for the attachments instead of using HWF database backend. This feature adds all content server document lifecycle capabilities to HWF attachments (versioning, RBAC, metadata management, etc). As of today, only Oracle WCC is supported. However, Oracle BPM Suite does include a license of Oracle WCC for the solely usage of document management within BPM scope. Here are some code samples that leverage the above features. Retrieving uploaded attachments -Non UCM- Non UCM attachments (default ones or those that have existed from 10g, and are stored "as-is" in HWK database backend) can be retrieved after the completion of the Human Task. Firstly, we need to know whether any attachment has been effectively uploaded to the human task. There are two ways to find it out: Through an XPath function: Checking the execData/attachment[] structure. For example: Once we are sure one ore more attachments were uploaded to the Human Task, we want to get them. In this example, by "get" I mean to get the attachment name and the payload of the file. Aside note: Oracle HWF lets you to upload two kind of [non-UCM] attachments: a desktop document and a Web URL. This example focuses just on the desktop document one. In order to "retrieve" an uploaded Web URL, you can get it directly from the execData/attachment[] structure. Attachment content (payload) is retrieved through the getTaskAttachmentContents() XPath function: This example shows how to retrieve as many attachments as those had been uploaded to the Human Task and write them to the server using the File Adapter service. The sample process excerpt is as follows:  A dummy UserTask using "HumanTask1" Human Task followed by a Embedded Subprocess that will retrieve the attachments (we're assuming at least one attachment is uploaded): and once retrieved, we will write each of them back to a file in the server using a File Adapter service: In detail: We've defined an XSD structure that will hold the attachments (both name and payload): Then, we can create a BusinessObject based on such element (attachmentCollection) and create a variable (named attachmentBPM) of such BusinessObject type. We will also need to keep a copy of the HumanTask output's execData structure. Therefore we need to create a variable of type TaskExecutionData... ...and copy the HumanTask output execData to it: Now we get into the embedded subprocess that will retrieve the attachments' payload. First, and using an XSLT transformation, we feed the attachmentBPM variable with the name of each attachment and setting an empty value to the payload: Please note that we're using the XSLT for-each node to create as many target structures as necessary. Also note that we're setting an Empty text to the payload variable. The reason for this is to make sure the <payload></payload> tag gets created. This is needed when we map the payload to the XML variable later. Aside note: We are assuming that we're retrieving non-UCM attachments. However in real life you might want to check the type of attachment you're handling. The execData/attachment[]/storageType contains the values "UCM" for UCM type attachments, "TASK" for non-UCM ones or "URL" for Web URL ones. Those values are part of the "Ext.Com.Oracle.Xmlns.Bpel.Workflow.Task.StorageTypeEnum" enumeration. Once we have fed the attachmentsBPM structure and so it now contains the name of each of the attachments, it is time to iterate through it and get the payload. Therefore we will use a new embedded subprocess of type MultiInstance, that will iterate over the attachmentsBPM/attachment[] element: In every iteration we will use a Script activity to map the corresponding payload element with the result of the XPath function getTaskAttachmentContents(). Please, note how the target array element is indexed with the loopCounter predefined variable, so that we make sure we're feeding the right element during the array iteration:  The XPath function used looks as follows: hwf:getTaskAttachmentContents(bpmn:getDataObject('UserTask1LocalExecData')/ns1:systemAttributes/ns1:taskId, bpmn:getDataObject('attachmentsBPM')/ns:attachment[bpmn:getActivityInstanceAttribute('SUBPROCESS3067107484296', 'loopCounter')]/ns:fileName)  where the input parameters are: taskId of the just completed Human Task attachment name we're retrieving the payload from array index (loopCounter predefined variable)  Aside note: The reason whereby we're iterating the execData/attachment[] structure through embedded subprocess and not, i.e., using XSLT and for-each nodes, is mostly because the getTaskAttachmentContents() XPath function is currently not available in XSLT mappings. So all this example might be considered as a workaround until this gets fixed/enhanced in future releases. Once this embedded subprocess ends, we will have all attachments (name + payload) in the attachmentsBPM variable, which is the main goal of this sample. But in order to test everything runs fine, we finish the sample writing each attachment to a file. To that end we include a final embedded subprocess to concurrently iterate through each attachmentsBPM/attachment[] element: On each iteration we will use a Service activity that invokes a File Adapter write service. In here we have two important parameters to set. First, the payload itself. The file adapter awaits binary data in base64 format (string). We have to map it using XPath (Simple mapping doesn't recognize a String as a base64-binary valid target):  Second, we must set the target filename using the Service Properties dialog box:  Again, note how we're making use of the loopCounter index variable to get the right element within the embedded subprocess iteration. Handling UCM attachments will be part of a different and upcoming blog entry. Once I finish will all posts on this matter, I will upload the whole sample project to java.net.

    Read the article

  • Download the ZFSSA Objection Handling document (PDF)

    - by swalker
    View and download the new ZFS Storage Appliance objection handling document from the Oracle HW Technical Resource Centre here. This document aims to address the most common objections encountered when positioning the ZFS Storage Appliance disk systems in production environments. It will help you to be more successful in establishing the undeniable benefits of the Oracle ZFS Storage Appliance in your customers´ IT environments. If you do not already have an account to access the Oracle Hardware Technical Resource Centre, please click here and follow the instructions to register.

    Read the article

  • Exception Handling Differences Between 32/64 Bit

    - by Alois Kraus
    I do quite a bit of debugging .NET applications but from time to time I see things that are impossible (at a first look). I may ask you dear reader what your mental exception handling model is. Exception handling is easy after all right? Lets suppose the following code:         private void F1(object sender, EventArgs e)         {             try             {                 F2();             }             catch (Exception ex)             {                 throw new Exception("even worse Exception");             }           }           private void F2()         {             try             {                 F3();             }             finally             {                 throw new Exception("other exception");             }         }           private void F3()         {             throw new NotImplementedException();         }   What will the call stack look like when you break into the catch(Exception) clause in Windbg (32 and 64 bit on .NET 3.5 SP1)? The mental model I have is that when an exception is thrown the stack frames are unwound until the catch handler can execute. An exception does propagate the call chain upwards.   So when F3 does throw an exception the control flow will resume at the finally handler in F2 which does throw another exception hiding the original one (that is nasty) and then the new Exception will be catched in F1 where the catch handler is executed. So we should see in the catch handler in F1 as call stack only the F1 stack frame right? Well lets try it out in Windbg. For this I created a simple Windows Forms application with one button which does execute the F1 method in its click handler. When you compile the application for 64 bit and the catch handler is reached you will find with the following commands in Windbg   Load sos extension from the same path where mscorwks was loaded in the current process .loadby sos mscorwks   Beak on clr exceptions sxe clr   Continue execution g   Dump mixed call stack container C++  and .NET Stacks interleaved 0:000> !DumpStack OS Thread Id: 0x1d8 (0) Child-SP         RetAddr          Call Site 00000000002c88c0 000007fefa68f0bd KERNELBASE!RaiseException+0x39 00000000002c8990 000007fefac42ed0 mscorwks!RaiseTheExceptionInternalOnly+0x295 00000000002c8a60 000007ff005dd7f4 mscorwks!JIT_Throw+0x130 00000000002c8c10 000007fefa6942e1 WindowsFormsApplication1!WindowsFormsApplication1.Form1.F1(System.Object, System.EventArgs)+0xb4 00000000002c8c60 000007fefa661012 mscorwks!ExceptionTracker::CallHandler+0x145 00000000002c8d60 000007fefa711a72 mscorwks!ExceptionTracker::CallCatchHandler+0x9e 00000000002c8df0 0000000077b055cd mscorwks!ProcessCLRException+0x25e 00000000002c8e90 0000000077ae55f8 ntdll!RtlpExecuteHandlerForUnwind+0xd 00000000002c8ec0 000007fefa637c1a ntdll!RtlUnwindEx+0x539 00000000002c9560 000007fefa711a21 mscorwks!ClrUnwindEx+0x36 00000000002c9a70 0000000077b0554d mscorwks!ProcessCLRException+0x20d 00000000002c9b10 0000000077ae5d1c ntdll!RtlpExecuteHandlerForException+0xd 00000000002c9b40 0000000077b1fe48 ntdll!RtlDispatchException+0x3cb 00000000002ca220 000007fefdaeaa7d ntdll!KiUserExceptionDispatcher+0x2e 00000000002ca7e0 000007fefa68f0bd KERNELBASE!RaiseException+0x39 00000000002ca8b0 000007fefac42ed0 mscorwks!RaiseTheExceptionInternalOnly+0x295 00000000002ca980 000007ff005dd8df mscorwks!JIT_Throw+0x130 00000000002cab30 000007fefa6942e1 WindowsFormsApplication1!WindowsFormsApplication1.Form1.F2()+0x9f 00000000002cab80 000007fefa71b5b3 mscorwks!ExceptionTracker::CallHandler+0x145 00000000002cac80 000007fefa70dcd0 mscorwks!ExceptionTracker::ProcessManagedCallFrame+0x683 00000000002caed0 000007fefa7119af mscorwks!ExceptionTracker::ProcessOSExceptionNotification+0x430 00000000002cbd90 0000000077b055cd mscorwks!ProcessCLRException+0x19b 00000000002cbe30 0000000077ae55f8 ntdll!RtlpExecuteHandlerForUnwind+0xd 00000000002cbe60 000007fefa637c1a ntdll!RtlUnwindEx+0x539 00000000002cc500 000007fefa711a21 mscorwks!ClrUnwindEx+0x36 00000000002cca10 0000000077b0554d mscorwks!ProcessCLRException+0x20d 00000000002ccab0 0000000077ae5d1c ntdll!RtlpExecuteHandlerForException+0xd 00000000002ccae0 0000000077b1fe48 ntdll!RtlDispatchException+0x3cb 00000000002cd1c0 000007fefdaeaa7d ntdll!KiUserExceptionDispatcher+0x2e 00000000002cd780 000007fefa68f0bd KERNELBASE!RaiseException+0x39 00000000002cd850 000007fefac42ed0 mscorwks!RaiseTheExceptionInternalOnly+0x295 00000000002cd920 000007ff005dd968 mscorwks!JIT_Throw+0x130 00000000002cdad0 000007ff005dd875 WindowsFormsApplication1!WindowsFormsApplication1.Form1.F3()+0x48 00000000002cdb10 000007ff005dd786 WindowsFormsApplication1!WindowsFormsApplication1.Form1.F2()+0x35 00000000002cdb60 000007ff005dbe6a WindowsFormsApplication1!WindowsFormsApplication1.Form1.F1(System.Object, System.EventArgs)+0x46 00000000002cdbc0 000007ff005dd452 System_Windows_Forms!System.Windows.Forms.Control.OnClick(System.EventArgs)+0x5a   Hm okaaay. I see my method F1 two times in this call stack. Looks like we did get some recursion bug. But that can´t be given the obvious code above. Let´s try the same thing in a 32 bit process.  0:000> !DumpStack OS Thread Id: 0x33e4 (0) Current frame: KERNELBASE!RaiseException+0x58 ChildEBP RetAddr  Caller,Callee 0028ed38 767db727 KERNELBASE!RaiseException+0x58, calling ntdll!RtlRaiseException 0028ed4c 68b9008c mscorwks!Binder::RawGetClass+0x20, calling mscorwks!Module::LookupTypeDef 0028ed5c 68b904ff mscorwks!Binder::IsClass+0x23, calling mscorwks!Binder::RawGetClass 0028ed68 68bfb96f mscorwks!Binder::IsException+0x14, calling mscorwks!Binder::IsClass 0028ed78 68bfb996 mscorwks!IsExceptionOfType+0x23, calling mscorwks!Binder::IsException 0028ed80 68bfbb1c mscorwks!RaiseTheExceptionInternalOnly+0x2a8, calling KERNEL32!RaiseExceptionStub 0028eda8 68ba0713 mscorwks!Module::ResolveStringRef+0xe0, calling mscorwks!BaseDomain::GetStringObjRefPtrFromUnicodeString 0028edc8 68b91e8d mscorwks!SetObjectReferenceUnchecked+0x19 0028ede0 68c8e910 mscorwks!JIT_Throw+0xfc, calling mscorwks!RaiseTheExceptionInternalOnly 0028ee44 68c8e734 mscorwks!JIT_StrCns+0x22, calling mscorwks!LazyMachStateCaptureState 0028ee54 68c8e865 mscorwks!JIT_Throw+0x1e, calling mscorwks!LazyMachStateCaptureState 0028eea4 02ffaecd (MethodDesc 0x7af08c +0x7d WindowsFormsApplication1.Form1.F1(System.Object, System.EventArgs)), calling mscorwks!JIT_Throw 0028eeec 02ffaf19 (MethodDesc 0x7af098 +0x29 WindowsFormsApplication1.Form1.F2()), calling 06370634 0028ef58 02ffae37 (MethodDesc 0x7a7bb0 +0x4f System.Windows.Forms.Control.OnClick(System.EventArgs))   That does look more familar. The call stack has been unwound and we do see only some frames into the history where the debugger was smart enough to find out that we have called F2 from F1. The exception handling on 64 bit systems does work quite differently which seems to have the nice property to remember the called methods not only during the first pass of exception filter clauses (during first pass all catch handler are called if they are going to catch the exception which is about to be thrown)  but also when the actual stack unwind has taken place. This makes it possible to follow not only the call stack right at the moment but also to look into the “history” of the catch/finally clauses. In a 64 bit process you only need to look at the ExceptionTracker to find out if a catch or finally handler was called. The two frames ProcessManagedCallFrame/CallHandler does indicate a finally clause whereas CallCatchHandler/CallHandler indicates a catch clause. That was a interesting one. Oh and by the way if you manage to load the Microsoft symbols you can also find out the hidden exception which. When you encounter in the call stack a line 0016eb34 75b79617 KERNELBASE!RaiseException+0x58 ====> Exception Code e0434f4d cxr@16e850 exr@16e838 Then it is a good idea to execute .exr 16e838 !analyze –v to find out more. In the managed world it is even easier since we can dump the objects allocated on the stack which have not yet been garbage collected to look at former method parameters. The command !dso which is the abbreviation for dump stack objects will give you 0:000> !dso OS Thread Id: 0x46c (0) ESP/REG  Object   Name 0016dd4c 020737f0 System.Exception 0016dd98 020737f0 System.Exception 0016dda8 01f5c6cc System.Windows.Forms.Button 0016ddac 01f5d2b8 System.EventHandler 0016ddb0 02071744 System.Windows.Forms.MouseEventArgs 0016ddc0 01f5d2b8 System.EventHandler 0016ddcc 01f5c6cc System.Windows.Forms.Button 0016dddc 020737f0 System.Exception 0016dde4 01f5d2b8 System.EventHandler 0016ddec 02071744 System.Windows.Forms.MouseEventArgs 0016de40 020737f0 System.Exception 0016de80 02071744 System.Windows.Forms.MouseEventArgs 0016de8c 01f5d2b8 System.EventHandler 0016de90 01f5c6cc System.Windows.Forms.Button 0016df10 02073784 System.SByte[] 0016df5c 02073684 System.NotImplementedException 0016e2a0 02073684 System.NotImplementedException 0016e2e8 01ed69f4 System.Resources.ResourceManager From there it is easy to do 0:000> !pe 02073684 Exception object: 02073684 Exception type: System.NotImplementedException Message: Die Methode oder der Vorgang sind nicht implementiert. InnerException: <none> StackTrace (generated):     SP       IP       Function     0016ECB0 006904AD WindowsFormsApplication2!WindowsFormsApplication2.Form1.F3()+0x35     0016ECC0 00690411 WindowsFormsApplication2!WindowsFormsApplication2.Form1.F2()+0x29     0016ECF0 0069038F WindowsFormsApplication2!WindowsFormsApplication2.Form1.F1(System.Object, System.EventArgs)+0x3f StackTraceString: <none> HResult: 80004001 to see the former exception. That´s all for today.

    Read the article

  • Handling permissions in a MVP application

    - by Chathuranga
    In a windows forms payroll application employing MVP pattern (for a small scale client) I'm planing user permission handling as follows (permission based) as basically its implementation should be less complicated and straight forward. NOTE : System could be simultaneously used by few users (maximum 3) and the database is at the server side. This is my UserModel. Each user has a list of permissions given for them. class User { string UserID { get; set; } string Name { get; set; } string NIC {get;set;} string Designation { get; set; } string PassWord { get; set; } List <string> PermissionList = new List<string>(); bool status { get; set; } DateTime EnteredDate { get; set; } } When user login to the system it will keep the current user in memory. For example in BankAccountDetailEntering view I control the controller permission as follows. public partial class BankAccountDetailEntering : Form { bool AccountEditable {get; set;} private void BankAccountDetailEntering_Load(object sender, EventArgs e) { cmdEditAccount.enabled = false; OnLoadForm (sender, e); // Event fires... If (AccountEditable ) { cmdEditAccount.enabled=true; } } } In this purpose my all relevant presenters (like BankAccountDetailPresenter) should aware of UserModel as well in addition to the corresponding business Model it is presenting to the View. class BankAccountDetailPresenter { BankAccountDetailEntering _View; BankAccount _Model; User _UserModel; DataService _DataService; BankAccountDetailPresenter( BankAccountDetailEntering view, BankAccount model, User userModel, DataService dataService ) { _View=view; _Model = model; _UserModel = userModel; _DataService = dataService; WireUpEvents(); } private void WireUpEvents() { _View.OnLoadForm += new EventHandler(_View_OnLoadForm); } private void _View_OnLoadForm(Object sender, EventArgs e) { foreach(string s in _UserModel.PermissionList) { If( s =="CanEditAccount") { _View.AccountEditable =true; return; } } } public Show() { _View.ShowDialog(); } } So I'm handling the user permissions in the presenter iterating through the list. Should this be performed in the Presenter or View? Any other more promising ways to do this? Thanks.

    Read the article

  • Exception handling in 3-Tier Architecture

    Exception handling in 3-Tier Architecture using Enterprise Library...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Slowly Changing Dimensions handling in PowerPivot (and BISM?)

    - by Marco Russo (SQLBI)
    During the PowerPivot Workshop in London we received many interesting questions and Alberto had the inspiration to write this nice post about Slowly Changing Dimensions handling in PowerPivot. It is interesting the consideration about SCD Type I attributes in a SCD Type II dimension – you can probably generate them in a more dynamic way in PowerPivot (thanks to Vertipaq and DAX) instead of relying on a relational table containing all the data you need, which usually requires a more complex ETL process....(read more)

    Read the article

  • Handling SQL Server Errors

    This article covers the basics of TRY CATCH error handling in T-SQL introduced in SQL Server 2005. It includes the usage of common functions to return information about the error and using the TRY CATCH block in stored procedures and transactions.

    Read the article

  • Gracefully Handling Deadlocks

    - by Derek Dieter
    In some situations, deadlocks may need to be dealt with not by changing the source of the deadlock, but by changing handling the deadlock gracefully. An example of this may be an external subscription that runs on a schedule deadlocking with another process. If the subscription deadlocks then it would be ok to [...]

    Read the article

  • On Handling Dates in SQL

    The calendar is inherently complex by the very nature of the astronomy that underlies the year, and the conflicting historical conventions. The handling of dates in TSQL is even more complex because, when SQL Server was Sybase, it was forced by the lack of prevailing standards in SQL to create its own ways of processing and formatting dates and times. Joe Celko looks forward to a future when it is possible to write standard SQL date-processing code with SQL Server.

    Read the article

  • Item Framework for Handling INamingContainer

    Item Framework for Handling INamingContainer...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Handling SQL Server Errors

    This article covers the basics of TRY CATCH error handling in T-SQL introduced in SQL Server 2005. It includes the usage of common functions to return information about the error and using the TRY CATCH block in stored procedures and transactions.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

< Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >