Search Results

Search found 30243 results on 1210 pages for 'protein database'.

Page 232/1210 | < Previous Page | 228 229 230 231 232 233 234 235 236 237 238 239  | Next Page >

  • GWT Date Picker Format problem when saving a java date through hibernate in postgresql

    - by Noor
    Hi, I am using Java Date and Hibernate which is then being saved in the database (Postgresql). I am not that good in hibernate Part of the Mapping File <property name="DateOfBirth" type="java.util.Date"> <column name="DATEOFBIRTH" /> </property> I am using GWT Date picker Short date format i.e. yyyy-MM-dd. I am getting the value from the date picker using View.getUserDateOfBirth().getValue() But when I am saving the date 2010-11-30 into the datebase it is saving it as 2010-11-30 00:00:00 instead of 2010-11-30 So, I want it to be saved in the database as in this format 2010-11-30?? I have many things such timestamp but i not being able to configure it. I think this part <property name="DateOfBirth" type="java.util.Date"> <column name="DATEOFBIRTH" /> </property> should be changed but I do not know what to change

    Read the article

  • How to automate database updates at webserver

    - by user221919
    hi I am developing the online bidding system using asp.net where I need to close the auction if the auction time is get closed without any bid. As in the following web site : http://www.bidrivals.com/us/ Please help me to resolve to this problem. Waiting for your valuable thoughts. Thanking You.

    Read the article

  • Linq to Sql Data class in dbml

    - by Simon
    I am abit curious about dbml.... Should I create one dbml file for one database or separated into different parts e.g. User dbml (only tables relate to users) etc? When I do this I will have abit of problems. Assume the User dbml has a User table and if the Order dbml has a User table as well, this won't be allowed if the entity namespace are the same. If I have set a different entity namespace for each of the dbml, it works but this will gives me a different entity of User table. When a single data returns to Business Logic layer, there is a difficulty of knowing which entity namespace of the user table to be used. If I built one dbml file instead of having separate dbml, will single dbml appear slower than the separated dbml version when fetching the data from the database.

    Read the article

  • Help to chouse NoSQL database for project

    - by potapuff
    There is a table: doc_id(integer)-value(integer) Approximate 100k doc_id and 27?? rows. Majority query on this table - searching documents similar to current document: select 10 documents with maximum of (count common to current document value)/(count ov values in document). Nowadays we use PostgreSQL. Table weight (with index) ~1,5 GB. Average query time ~0.5s. Should I transfer all this to NoSQL base, if so, what?

    Read the article

  • best way to statistically detect anomalies in data

    - by reinier
    Hi, our webapp collects huge amount of data about user actions, network business, database load, etc etc etc All data is stored in warehouses and we have quite a lot of interesting views on this data. if something odd happens chances are, it shows up somewhere in the data. However, to manually detect if something out of the ordinary is going on, one has to continually look through this data, and look for oddities. My question: what is the best way to detect changes in dynamic data which can be seen as 'out of the ordinary'. Are bayesan filters (I've seen these mentioned when reading about spam detection) the way to go? Any pointers would be great! EDIT: To clarify the data for example shows a daily curve of database load. This curve typically looks similar to the curve from yesterday In time this curve might change slowly. It would be nice that if the curve from day to day changes say within some perimeters, a warning could go off. R

    Read the article

  • Adding to database with multiple text boxes

    - by kira423
    What I am trying to do with this script is allow users to update a url for their websites, and since each user isn't going to have the same amount of websites is is hard for me to just add $_POST['website'] for each of these. Here is the script <?php include("config.php"); include("header.php"); include("functions.php"); if(!isset($_SESSION['username']) && !isset($_SESSION['password'])){ header("Location: pubs.php"); } $getmember = mysql_query("SELECT * FROM `publishers` WHERE username = '".$_SESSION['username']."'"); $info = mysql_fetch_array($getmember); $getsites = mysql_query("SELECT * FROM `websites` WHERE publisher = '".$info['username']."'"); $postback = $_POST['website']; $webname = $_POST['webid']; if($_POST['submit']){ var_dump( $_POST['website'] ); $update = mysql_query("UPDATE `websites` SET `postback` = '$postback' WHERE name = '$webname'"); } print" <div id='center'> <span id='tools_lander'><a href='export.php'>Export Campaigns</a></span> <div id='calendar_holder'> <h3>Please define a postback for each of your websites below. The following variables should be used when creating your postback.<br /> cid = Campaign ID<br /> sid = Sub ID<br /> rate = Campaign Rate<br /> status = Status of Lead. 1 means payable 2 mean reversed<br /> A sample postback URL would be <br /> http://www.example.com/postback.php?cid=#cid&sid=#sid&rate=#rate&status=#status</h3> <table class='balances' align='center'> <form method='POST' action=''>"; while($website = mysql_fetch_array($getsites)){ print" <tr> <input type ='hidden' name='webid' value='".$website['id']."' /> <td style='font-weight:bold;'>".$website['name']."'s Postback:</td> <td><input type='text' style='width:400px;' name='website[]' value='".$website['postback']."' /></td> </tr>"; } print" <td style='float:right;position:relative;left:150px;'><input type='submit' name='submit' style='font-size:15px;height:30px;width:100px;' value='Submit' /></td> </form> </table> </div>"; include("footer.php"); ?> What I am attempting to do insert the what is inputted in the text boxes to their corresponding websites, and I cannot think of any other way to do it, and this obviously does not works and returns a notice stating Array to string conversion If there is a more logical way to do this please let me know.

    Read the article

  • The CHOICE : Firebird or H2

    - by blow
    Hi, i have to choice a database to use in server-mode for a java desktop application. I think both are great java database. In my opinion (im NOT well-informed): H2 PRO Is java based Develeopment say it is very very fast Easy to install, configure and use with java application H2 CONS Is a young project Reliability doubt for commercial porpouse FireBird PRO Rock solid project Well documented Should be fast and well optimized for large data Has a java driver... FireBird CONS It is not java based ... ? So, i can't choice between this great db, can i have a suggestion? Thank.

    Read the article

  • Merging two SQLite database files (C# .NET)

    - by CODe
    Hello all, I'm using C#/.NET with the C# wrapper for SQLite. I'm attempting to merge two SQLite databases together while excluding duplicates. I found this, which is referenced from a few different forum questions. http://old.nabble.com/Attempting-to-merge-large-databases-td18131366.html Would I run the following queries in my SQLite configuration as listed below? attach 'c:\test\b.db3' as toMerge; insert into AuditRecords select * from toMerge.AuditRecords; My main question is whether the above will remove duplicates, and if it doesn't, is there a merge or some other command I can use? Thanks very much!

    Read the article

  • ASP.NET MVC 3 Linq uppercase or lowercase database search

    - by user1495557
    I need immediate help. ): and i know little english. ASP.NET MVC 3 Linq uppercase or lowercase contains search Example: string metin="baris"; var IcerikAra = (from icerik in Context.dbDokumanEditor join kategori in Context.dbDokumanKategori on icerik.KategoriID equals kategori.KategoriID where icerik.Icerik.toLower().Contains(metin) select new { KategoriID=kategori. KategoriAd=kategori.KategoriAd }).ToList(); Exception: StackTrace: at System.Data.EntityClient.EntityCommandDefinition.ExecuteStoreCommands(EntityCommandentityCommand, CommandBehavior behavior) at System.Data.Objects.Internal.ObjectQueryExecutionPlan.Execute[TResultType](ObjectContext context, ObjectParameterCollection parameterValues) at System.Data.Objects.ObjectQuery`1.GetResults(Nullable`1 forMergeOption) at System.Data.Objects.ObjectQuery`1.System.Collections.Generic.IEnumerable.GetEnumerator() at System.Data.Entity.Internal.Linq.InternalQuery`1.GetEnumerator() at System.Data.Entity.Infrastructure.DbQuery`1.System.Collections.Generic.IEnumerable.GetEnumerator() at System.Collections.Generic.List`1..ctor(IEnumerable`1 collection) at System.Linq.Enumerable.ToList[TSource](IEnumerable`1 source) at Plus.Areas.DokumanEditor.Controllers.DokumanController.DokumanIcerikAramaBaslat(String metin) Error Message: An error occurred while executing the command definition. See the inner exception for details. thanks..

    Read the article

  • ASP NET MVC (loading data from database)

    - by rah.deex
    hi experts, its me again... i have some code like this.. using System; using System.Collections.Generic; using System.Linq; using System.Web; namespace MvcGridSample.Models { public class CustomerService { private List<SVC> Customers { get { List<SVC> customers; if (HttpContext.Current.Session["Customers"] != null) { customers = (List<SVC>) HttpContext.Current.Session["Customers"]; } else { //Create customer data store and save in session customers = new List<SVC>(); InitCustomerData(customers); HttpContext.Current.Session["Customers"] = customers; } return customers; } } public SVC GetByID(int customerID) { return this.Customers.AsQueryable().First(customer => customer.seq_ == customerID); } public IQueryable<SVC> GetQueryable() { return this.Customers.AsQueryable(); } public void Add(SVC customer) { this.Customers.Add(customer); } public void Update(SVC customer) { } public void Delete(int customerID) { this.Customers.RemoveAll(customer => customer.seq_ == customerID); } private void InitCustomerData(List<SVC> customers) { customers.Add(new SVC { ID = 1, FirstName = "John", LastName = "Doe", Phone = "1111111111", Email = "[email protected]", OrdersPlaced = 5, DateOfLastOrder = DateTime.Parse("5/3/2007") }); customers.Add(new SVC { ID = 2, FirstName = "Jane", LastName = "Doe", Phone = "2222222222", Email = "[email protected]", OrdersPlaced = 3, DateOfLastOrder = DateTime.Parse("4/5/2008") }); customers.Add(new SVC { ID = 3, FirstName = "John", LastName = "Smith", Phone = "3333333333", Email = "[email protected]", OrdersPlaced = 25, DateOfLastOrder = DateTime.Parse("4/5/2000") }); customers.Add(new SVC { ID = 4, FirstName = "Eddie", LastName = "Murphy", Phone = "4444444444", Email = "[email protected]", OrdersPlaced = 1, DateOfLastOrder = DateTime.Parse("4/5/2003") }); customers.Add(new SVC { ID = 5, FirstName = "Ziggie", LastName = "Ziggler", Phone = null, Email = "[email protected]", OrdersPlaced = 0, DateOfLastOrder = null }); customers.Add(new SVC { ID = 6, FirstName = "Michael", LastName = "J", Phone = "666666666", Email = "[email protected]", OrdersPlaced = 5, DateOfLastOrder = DateTime.Parse("12/3/2007") }); } } } those codes is an example that i've got from the internet.. in that case, the data is created and saved in session before its shown.. the things that i want to ask is how if i want to load the data from table? i'am a newbie here.. please help :) thank b4 for advance..

    Read the article

  • how escape quotes when inserting into database in PHP

    - by Mauro74
    Hi all, I'm quite new to PHP so sorry if sounds such an easy problem... :) I'm having an error message when inserting content which contains quotes into my db. here's what I tried trying to escape the quotes but didn't work: $con = mysql_connect("localhost","xxxx","xxxxx"); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("test", $con); $nowdate = date('d-m-Y') $title = sprintf($_POST[title], mysql_real_escape_string($_POST[title])); $body = sprintf($_POST[body], mysql_real_escape_string($_POST[body])); $sql="INSERT INTO articles (title, body, date) VALUES ('$title','$body','$nowdate'),"; if (!mysql_query($sql,$con)) { die('Error: ' . mysql_error()); } header('Location: index.php'); Could you provide any solution please? Thanks in advance. Mauro

    Read the article

  • Is there a C# open-source search app which scales cheaply?

    - by domspurling
    I need to quickly replace a listings website which has the following characteristics: smallish database (10,000 items, < 1GB) < 10% of the items updated/created/removed daily most common activity is searching the whole dataset, returning 1-1000 items traffic peaks at 1m page impressions per day Scaling strategy for the existing app has been to separate read-only and read/write activity. Multiple slave databases are used for searching and writes are done to a master, which update the slaves using MS SQL replication. Since read activity is more common than write, this has proved to be a cheap way to do database load balancing, without true clustering. I now need to replace the app - are there any C# open-source apps which scale as neatly as this?

    Read the article

  • Database tools

    - by L G
    Hi, Can any one out there suggest a microsoft tool similar to Red Gate's sql promt,sql compare,sql data compare etc.Any help is appreciated.Thanks

    Read the article

  • Display database content which is last inserted using last inserted ID

    - by user2330772
    What i am doing is i am displaying last inserted data when form data is submitted,the form is multipart/form-data. I am getting this form data using jquery,here i am sending this data to php file using Ajax POST.In that php file i am inserting that data in db table..where i am getting the id of inserted data..on success of Ajax call i am sending that id to another PHP file..where using that id i am displaying the last inserted data... My form is: <form method="post" enctype="multipart/form-data" name="upload_form" id="data"> <select id="sel"> <option>Select the Project Stream</option> <option value="1">Computer Science</option> <option value="2">Mechanical</option> <option value="3">IT</option> <option value="4">Web Development</option> <option value="5">MCA</option> <option value="6">Civil</option> </select><br /> <input type="text" id="title" placeholder="Project Title"/><br /> <input type="text" id="vurl" placeholder="If You have any video about project write your video url path here" style="width:435px;"/><br /> <textarea id="prjdesc" name="prjdesc" rows="20" cols="80" style="border-style:groove;box-shadow: 10px 10px 10px 10px #888888;"placeholder="Please describe Your Project"></textarea> <label for="file">Filename:</label> <input type="file" name="file" id="file"/><br /> <button>Submit</button> </form> My js file: $("form#data").submit(function() { alert("update"); var sid=$("#sel").val(); alert(sid); var ttle = $("#title").val(); alert(ttle); var text = $("#prjdesc").val(); var vurl = $("#vurl").val(); /*var dataString = 'param='+text+'&param1='+vurl+'&param2='+ttle+'&param3='+id;*/ var formData = new FormData($(this)[0]); formData.append('param',text); formData.append('param1',vurl); formData.append('param2',ttle ); formData.append('param3',sid ); $.ajax({ type:'POST', data:formData, url:'insert.php', success:function(id) { alert(id); window.location ="another.php?id="+id; }, cache: false, contentType: false, processData: false }); return false; }); insert.php: <?php print_r($_FILES); $desc = $_POST['param']; echo $desc; $video = $_POST['param1']; echo $video ; $title = $_POST['param2']; echo $title; $tech_id=$_POST['param3']; echo $tech_id; $host="localhost"; $username="root"; $password=""; $db_name="geny"; $tbl_name="project_details"; mysql_connect("$host", "$username", "$password")or die("cannot connect"); mysql_select_db("$db_name")or die("cannot select DB"); $allowedExts = array("gif", "jpeg", "jpg", "png"); $extension = end(explode(".", $_FILES["file"]["name"])); $url_dir = "C:/wamp/www/WebsiteTemplate4/upload/"; if ((($_FILES["file"]["type"] == "image/gif") || ($_FILES["file"]["type"] == "image/jpeg") || ($_FILES["file"]["type"] == "image/jpg") || ($_FILES["file"]["type"] == "image/pjpeg") || ($_FILES["file"]["type"] == "image/x-png") || ($_FILES["file"]["type"] == "image/png")) && ($_FILES["file"]["size"] < 50000) && in_array($extension, $allowedExts)) { if ($_FILES["file"]["error"] > 0) { echo "Return Code: " . $_FILES["file"]["error"] . "<br>"; } else { if (file_exists($url_dir . $_FILES["file"]["name"])) { echo $_FILES["file"]["name"] . " already exists. "; } else { move_uploaded_file($_FILES["file"]["tmp_name"],$url_dir. $_FILES["file"]["name"]); // echo "Stored in: " . "upload/" . $_FILES["file"]["name"]; $tmp = "C:/wamp/www/WebsiteTemplate4/upload/" . $_FILES["file"]["name"]; $sql="INSERT INTO $tbl_name (title, content, img_path, video_url, project_tech_Id) VALUES ('$title','$desc','$tmp','$video','$tech_id')"; if(mysql_query($sql)) { echo mysql_insert_id(); } else { echo "Cannot Insert"; } } } } else { echo "Invalid file"; } ?> another.php: <?php $temp=$_GET['id']; echo $temp; $host="localhost"; $username="root"; $password=""; $db_name="geny"; $tbl_name="project_details"; mysql_connect("$host", "$username", "$password")or die("cannot connect"); mysql_select_db("$db_name")or die("cannot select DB"); $query = mysql_query("SELECT content FROM project_details WHERE id=". $temp); if (!$query) { echo 'Could not run query: ' . mysql_error(); exit; } $row = mysql_fetch_row($query); echo "<div id='uprjct' style='background:#336699;'> <p>$row[0]</p> </div>"; ?> but the ID what i am returning in insert.php containg array of elements...i dont want all these thing i want only ID(which is number).. please tell me what is wrong in my code...

    Read the article

  • XSD data set with Oracle database

    - by Ed Woodcock
    Hi folks, I'm having a major issue with an XSD dataset mapping thingy that I'm using within my current project. We are using XSDs for some data abstraction (it's quicker and debatably more maintainable that using Parameterised SQL or a StoredProc), and on my machine (running in the VS development environment) thy're working fine. However, on the Pre-production server we use for our testing, the XSDs are not working correctly: some method calls will fail with the following error: System.ArgumentException: Value does not fall within the expected range. at Oracle.DataAccess.Client.OracleParameter.set_DbType(DbType value) Has anyone ever encountered this issue before? The methods being called are simple select statements using 1-3 parameters, and as I said before they work fine on my machine.

    Read the article

  • How to aviod duplication entry via form into database

    - by DAFFODIL
    <?php $con = mysql_connect("localhost","root",""); if (!$con) { die('Could not connect: ' . mysql_error()); } mysql_select_db("form", $con); $reb = "select count(*) from customer where name = '$name';" if (mysql_result($reb,0) > 0) { echo "Item Already Added!<br>"; } else { // add the item } mysql_close($con); header( 'Location: http://localhost/cus.php' ); ?> Parse error: parse error in C:\wamp\www\c.php on line 10

    Read the article

  • asp.net cannot update database

    - by tom
    string ConnectionString = WebConfigurationManager.ConnectionStrings["dbnameConnectionString"].ConnectionString; SqlConnection myConnection = new SqlConnection(ConnectionString); myConnection.Open(); try { string qry = "UPDATE customers SET firstname=@firstname WHERE cid=1"; SqlCommand insertQuery = new SqlCommand(qry, myConnection); insertQuery.Parameters.Add(new SqlParameter("@firstname", txtFirstname.Text)); insertQuery.ExecuteNonQuery(); myConnection.Close(); } catch (Exception ee) { } Any suggestions?

    Read the article

  • Fully automated SQL Server Restore

    - by hasen j
    I'm not very fluent with SQL Server commands. I need a script to restore a database from a .bak file and move the logical_data and logical_log files to a specific path. I can do: restore filelistonly from disk='D:\backups\my_backup.bak' This will give me a result set with a column LogicalName, next I need to use the logical names from the result set in the restore command: restore database my_db_name from disk='d:\backups\my_backups.bak' with file=1, move 'logical_data_file' to 'd:\data\mydb.mdf', move 'logical_log_file' to 'd:\data\mylog.ldf' How do I capture the logical names from the first result set into variables that can be supplied to the "move" command? I think the solution might be trivial, but I'm pretty new to SQL Server.

    Read the article

  • WebService or WebRequest for database updates in ASP.NET

    - by eugeneK
    I'm currently making some system that will gather statistical reports from different sites, for any user transaction in there. My question is for would be better to implement from you experience ... All websites that will report data to statistics sites are on my servers. So whats better to user WebRequest to send GET data to page or to use Webservice for that... thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can't insert a record in a oracle database using C#

    - by Gya
    try { int val4 = Convert.ToInt32(tbGrupa.Text); string MyConString = "Data Source=**;User ID=******;Password=*****"; OracleConnection conexiune = new OracleConnection(MyConString); OracleCommand comanda = new OracleCommand(); comanda.Connection = conexiune; conexiune.Open(); comanda.Transaction = conexiune.BeginTransaction(); int id_stud = Convert.ToInt16(tbCodStud.Text); string nume = tbNume.Text; string prenume = tbPrenume.Text; string initiala_tatalui = tbInitiala.Text; string email = tbEmail.Text; string facultate = tbFac.Text; int grupa = Convert.ToInt16(tbGrupa.Text); string serie = tbSeria.Text; string forma_de_inv = tbFormaInvatamant.Text; DateTime data_acceptare_coordonare = dateTimePicker1.Value; DateTime data_sustinere_licenta = dateTimePicker2.Value; string sustinere = tbSustinereLicenta.Text; string parola_acces = tbParola.Text; try { comanda.Parameters.AddWithValue("id_stud", id_stud); comanda.Parameters.AddWithValue("nume", nume); comanda.Parameters.AddWithValue("prenume", prenume); comanda.Parameters.AddWithValue("initiala_tatalui", initiala_tatalui); comanda.Parameters.AddWithValue("facultate", facultate); comanda.Parameters.AddWithValue("email", email); comanda.Parameters.AddWithValue("seria", serie); comanda.Parameters.AddWithValue("grupa", grupa); comanda.Parameters.AddWithValue("forma_de_inv", forma_de_inv); comanda.Parameters.AddWithValue("data_acceptare_coordonare", data_acceptare_coordonare); comanda.Parameters.AddWithValue("data_sustinere_licenta", data_sustinere_licenta); comanda.Parameters.AddWithValue("sustinere_licenta", sustinere); comanda.Parameters.AddWithValue("parola_acces", parola_acces); comanda.Transaction.Commit(); MessageBox.Show("Studentul " + tbNume.Text + " " + tbPrenume.Text + " a fost adaugat în baza de date!"); } catch (Exception er) { comanda.Transaction.Rollback(); MessageBox.Show("ER1.1:" + er.Message); MessageBox.Show("ER1.2:" + er.StackTrace); } finally { conexiune.Close(); } } catch (Exception ex) { MessageBox.Show("ER2.1:"+ex.Message); MessageBox.Show("ER2.2:"+ex.StackTrace); }

    Read the article

< Previous Page | 228 229 230 231 232 233 234 235 236 237 238 239  | Next Page >